Property Summary

NCBI Gene PubMed Count 165
Grant Count 57
R01 Count 39
Funding $10,279,671.34
PubMed Score 281.90
PubTator Score 517.01

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q02447 A0AVL9 B4E2B7 Q69B26 Q69B27 Q8TD56 Q8WWU4 Q9BQR1
Symbols SPR2

Gene

SP3

Gene RIF (136)

PMID Text
26807725 Sp1 and Sp3 are not only essential for the basal transcription of the ek1 gene, their accessibility to the target site on the ek1 promoter is regulated by histone protein modification in a cell line dependent manner.
26487723 result indicated that promoter binding by Sp1/Sp3 was essential, but not a limiting step, for hTERT transcription
26431879 O-GlcNAc modification of Sp3 and Sp4, but not Sp2 transcription factors negatively regulates their transcriptional activities.
26352013 Human SP1 and SP3 transcription factors regulate MALAT1 expression in hepatocellular carcinoma.
26162987 characterized two evolutionary highly conserved cis-regulatory modules (CRMs) within the proximal promoter each composed of one binding site for the transcription factors SP1 and SP3 as well as for the nuclear transcription factor Y
26012884 Sp3 was found to be a major regulator of BNIP3 in prostate cancer.
25797200 stimulates CCR7 expression during the course of dendritic cell maturation
25476526 These results suggest that XT-1 expression is refractory to the disease process and to inhibition by inflammatory cytokines and that signaling through AP-1, Sp1, and Sp3 is important in the maintenance of XT-1 levels in NP cells.
24710631 A novel GC-rich element (GRE) spanning -101/-66 sufficient for VEGFR3 transcription and activated by Sp1 and Sp3, respectively, was identified.
24315822 Sp1 and Sp3 are functionally involved as transcriptional integrators regulating the basal expression of the derived microsomal epoxide hydrolase E1b variant transcript.
More...

AA Sequence

MTAPEKPVKQEEMAALDVDSGGGGGGGGGHGEYLQQQQQHGNGAVAAAAAAQDTQPSPLALLAATCSKIG      1 - 70
PPSPGDDEEEAAAAAGAPAAAGATGDLASAQLGGAPNRWEVLSATPTTIKDEAGNLVQIPSAATSSGQYV     71 - 140
LPLQNLQNQQIFSVAPGSDSSNGTVSSVQYQVIPQIQSADGQQVQIGFTGSSDNGGINQESSQIQIIPGS    141 - 210
NQTLLASGTPSANIQNLIPQTGQVQVQGVAIGGSSFPGQTQVVANVPLGLPGNITFVPINSVDLDSLGLS    211 - 280
GSSQTMTAGINADGHLINTGQAMDSSDNSERTGERVSPDINETNTDTDLFVPTSSSSQLPVTIDSTGILQ    281 - 350
QNTNSLTTSSGQVHSSDLQGNYIQSPVSEETQAQNIQVSTAQPVVQHLQLQESQQPTSQAQIVQGITPQT    351 - 420
IHGVQASGQNISQQALQNLQLQLNPGTFLIQAQTVTPSGQVTWQTFQVQGVQNLQNLQIQNTAAQQITLT    421 - 490
PVQTLTLGQVAAGGAFTSTPVSLSTGQLPNLQTVTVNSIDSAGIQLHPGENADSPADIRIKEEEPDPEEW    491 - 560
QLSGDSTLNTNDLTHLRVQVVDEEGDQQHQEGKRLRRVACTCPNCKEGGGRGTNLGKKKQHICHIPGCGK    561 - 630
VYGKTSHLRAHLRWHSGERPFVCNWMYCGKRFTRSDELQRHRRTHTGEKKFVCPECSKRFMRSDHLAKHI    631 - 700
KTHQNKKGIHSSSTVLASVEAARDDTLITAGGTTLILANIQQGSVSGIGTVNTSATSNQDILTNTEIPLQ    701 - 770
LVTVSGNETME                                                               771 - 781
//

Text Mined References (182)

PMID Year Title
26807725 2016 Sp1 and Sp3 Are the Transcription Activators of Human ek1 Promoter in TSA-Treated Human Colon Carcinoma Cells.
26487723 2015 Human Telomerase Reverse Transcriptase (hTERT) Transcription Requires Sp1/Sp3 Binding to the Promoter and a Permissive Chromatin Environment.
26431879 2015 O-GlcNAc modification of Sp3 and Sp4 transcription factors negatively regulates their transcriptional activities.
26352013 2015 Sp1 cooperates with Sp3 to upregulate MALAT1 expression in human hepatocellular carcinoma.
26162987 2015 Functional interplay of SP family members and nuclear factor Y is essential for transcriptional activation of the human Calreticulin gene.
26012884 2015 Transcriptional regulation of BNIP3 by Sp3 in prostate cancer.
25797200 2015 NFAT-1, Sp-1, Sp-3, and miR-21: New regulators of chemokine C receptor 7 expression in mature human dendritic cells.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25476526 2015 Xylosyltransferase-1 expression is refractory to inhibition by the inflammatory cytokines tumor necrosis factor ? and IL-1? in nucleus pulposus cells: novel regulation by AP-1, Sp1, and Sp3.
More...