Property Summary

NCBI Gene PubMed Count 170
PubMed Score 289.52
PubTator Score 517.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
acute quadriplegic myopathy 1.239 9.5e-05
Amyotrophic lateral sclerosis 1.287 1.5e-06
autosomal dominant Emery-Dreifuss muscul... 1.132 5.9e-03
breast carcinoma 1.300 1.1e-02
group 3 medulloblastoma 1.500 1.0e-04
juvenile dermatomyositis 1.104 6.2e-09
medulloblastoma, large-cell 1.300 1.2e-03
Multiple myeloma 1.256 8.5e-03
osteosarcoma -1.106 3.8e-03
pediatric high grade glioma 1.200 2.1e-05
primary Sjogren syndrome 1.200 2.3e-02
primitive neuroectodermal tumor 1.200 6.1e-05
psoriasis -1.200 1.1e-03
tuberculosis -1.100 1.3e-05
Waldenstrons macroglobulinemia 1.325 3.7e-02

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (141)

AA Sequence

MTAPEKPVKQEEMAALDVDSGGGGGGGGGHGEYLQQQQQHGNGAVAAAAAAQDTQPSPLALLAATCSKIG      1 - 70
PPSPGDDEEEAAAAAGAPAAAGATGDLASAQLGGAPNRWEVLSATPTTIKDEAGNLVQIPSAATSSGQYV     71 - 140
LPLQNLQNQQIFSVAPGSDSSNGTVSSVQYQVIPQIQSADGQQVQIGFTGSSDNGGINQESSQIQIIPGS    141 - 210
NQTLLASGTPSANIQNLIPQTGQVQVQGVAIGGSSFPGQTQVVANVPLGLPGNITFVPINSVDLDSLGLS    211 - 280
GSSQTMTAGINADGHLINTGQAMDSSDNSERTGERVSPDINETNTDTDLFVPTSSSSQLPVTIDSTGILQ    281 - 350
QNTNSLTTSSGQVHSSDLQGNYIQSPVSEETQAQNIQVSTAQPVVQHLQLQESQQPTSQAQIVQGITPQT    351 - 420
IHGVQASGQNISQQALQNLQLQLNPGTFLIQAQTVTPSGQVTWQTFQVQGVQNLQNLQIQNTAAQQITLT    421 - 490
PVQTLTLGQVAAGGAFTSTPVSLSTGQLPNLQTVTVNSIDSAGIQLHPGENADSPADIRIKEEEPDPEEW    491 - 560
QLSGDSTLNTNDLTHLRVQVVDEEGDQQHQEGKRLRRVACTCPNCKEGGGRGTNLGKKKQHICHIPGCGK    561 - 630
VYGKTSHLRAHLRWHSGERPFVCNWMYCGKRFTRSDELQRHRRTHTGEKKFVCPECSKRFMRSDHLAKHI    631 - 700
KTHQNKKGIHSSSTVLASVEAARDDTLITAGGTTLILANIQQGSVSGIGTVNTSATSNQDILTNTEIPLQ    701 - 770
LVTVSGNETME                                                               771 - 781
//

Text Mined References (188)

PMID Year Title