Property Summary

NCBI Gene PubMed Count 42
PubMed Score 26.84
PubTator Score 106.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Bipolar Disorder 666 3.826 1.9
Schizophrenia 1160 0.0 0.0
Disease Target Count P-value
Breast cancer 3578 8.8e-13
ovarian cancer 8520 1.9e-05
primary Sjogren syndrome 735 3.1e-04
group 3 medulloblastoma 4104 1.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
lung cancer 4740 0.0 0.5
Disease Target Count Z-score Confidence
Mental Depression 333 0.0 0.9
Disease Target Count Z-score Confidence
Hereditary spastic paraplegia 4 7 3.153 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer -1.200 8.8e-13
group 3 medulloblastoma 1.200 1.3e-02
ovarian cancer -1.800 1.9e-05
primary Sjogren syndrome 1.200 3.1e-04

Protein-protein Interaction (3)

Gene RIF (30)

AA Sequence

MSDQKKEEEEEAAAAAAMATEGGKTSEPENNNKKPKTSGSQDSQPSPLALLAATCSKIGTPGENQATGQQ      1 - 70
QIIIDPSQGLVQLQNQPQQLELVTTQLAGNAWQLVASTPPASKENNVSQPASSSSSSSSSNNGSASPTKT     71 - 140
KSGNSSTPGQFQVIQVQNPSGSVQYQVIPQLQTVEGQQIQINPTSSSSLQDLQGQIQLISAGNNQAILTA    141 - 210
ANRTASGNILAQNLANQTVPVQIRPGVSIPLQLQTLPGTQAQVVTTLPINIGGVTLALPVINNVAAGGGT    211 - 280
GQVGQPAATADSGTSNGNQLVSTPTNTTTSASTMPESPSSSTTCTTTASTSLTSSDTLVSSADTGQYAST    281 - 350
SASSSERTIEESQTPAATESEAQSSSQLQPNGMQNAQDQSNSLQQVQIVGQPILQQIQIQQPQQQIIQAI    351 - 420
PPQSFQLQSGQTIQTIQQQPLQNVQLQAVNPTQVLIRAPTLTPSGQISWQTVQVQNIQSLSNLQVQNAGL    421 - 490
SQQLTITPVSSSGGTTLAQIAPVAVAGAPITLNTAQLASVPNLQTVSVANLGAAGVQVQGVPVTITSVAG    491 - 560
QQQGQDGVKVQQATIAPVTVAVGGIANATIGAVSPDQLTQVHLQQGQQTSDQEVQPGKRLRRVACSCPNC    561 - 630
REGEGRGSNEPGKKKQHICHIEGCGKVYGKTSHLRAHLRWHTGERPFICNWMFCGKRFTRSDELQRHRRT    631 - 700
HTGEKRFECPECSKRFMRSDHLSKHVKTHQNKKGGGTALAIVTSGELDSSVTEVLGSPRIVTVAAISQDS    701 - 770
NPATPNVSTNMEEF                                                            771 - 784
//

Text Mined References (47)

PMID Year Title