Property Summary

NCBI Gene PubMed Count 37
Grant Count 18
R01 Count 17
Funding $1,772,850.48
PubMed Score 24.84
PubTator Score 106.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.200 0.013
primary Sjogren syndrome 1.200 0.000
Breast cancer -1.200 0.000
ovarian cancer -1.800 0.000

Gene RIF (27)

PMID Text
26431879 O-GlcNAc modification of Sp3 and Sp4, but not Sp2 transcription factors negatively regulates their transcriptional activities.
26049820 Results indicate that SP4 S770 phosphorylation is increased in the cerebellum in bipolar disorder that committed suicide and in severe schizophrenia, and may be part of a degradation signal that controls Sp4 abundance in cerebellar granule neurons
25915526 Results found that SP4 S770 phosphorylation was significantly increased in lymphocytes in first-episode psychosis compared to controls.
25175639 The results of this study suggest that SP4 and SP1 upregulation may be part of the mechanisms deregulated downstream of glutamate signalling pathways in schizophrenia
23941741 This study shows reduced SP4 protein levels in first-episode psychosis in lymphocytes, suggesting that these transcription factors are potential peripheral biomarkers of psychotic spectrum disorders in the early stages.
23540600 This study showed that SP1, SP3 and SP4 protein levels inversely correlated with negative symptoms in the cerebellum.
22614877 Significantly increased SP4 relative expression levels are observed in patients with Alzheimer's disease, compared with controls.
22017217 This study demonistrated that The transcription factor SP4 is reduced in postmortem cerebellum of bipolar disorder subjects.
21919647 Ascorbic acid decreased RKO and SW480 colon cancer cell proliferation and induced apoptosis and necrosis, accompanied by downregulation of Sp1, Sp3, and Sp4 proteins.
20634195 Sp4 hypomorphic mice could therefore serve as a genetic model to investigate impaired NMDA functions resulting from loss-of-function mutations of human SP4 gene in schizophrenia and/or other psychiatric disorders.
More...

AA Sequence

MSDQKKEEEEEAAAAAAMATEGGKTSEPENNNKKPKTSGSQDSQPSPLALLAATCSKIGTPGENQATGQQ      1 - 70
QIIIDPSQGLVQLQNQPQQLELVTTQLAGNAWQLVASTPPASKENNVSQPASSSSSSSSSNNGSASPTKT     71 - 140
KSGNSSTPGQFQVIQVQNPSGSVQYQVIPQLQTVEGQQIQINPTSSSSLQDLQGQIQLISAGNNQAILTA    141 - 210
ANRTASGNILAQNLANQTVPVQIRPGVSIPLQLQTLPGTQAQVVTTLPINIGGVTLALPVINNVAAGGGT    211 - 280
GQVGQPAATADSGTSNGNQLVSTPTNTTTSASTMPESPSSSTTCTTTASTSLTSSDTLVSSADTGQYAST    281 - 350
SASSSERTIEESQTPAATESEAQSSSQLQPNGMQNAQDQSNSLQQVQIVGQPILQQIQIQQPQQQIIQAI    351 - 420
PPQSFQLQSGQTIQTIQQQPLQNVQLQAVNPTQVLIRAPTLTPSGQISWQTVQVQNIQSLSNLQVQNAGL    421 - 490
SQQLTITPVSSSGGTTLAQIAPVAVAGAPITLNTAQLASVPNLQTVSVANLGAAGVQVQGVPVTITSVAG    491 - 560
QQQGQDGVKVQQATIAPVTVAVGGIANATIGAVSPDQLTQVHLQQGQQTSDQEVQPGKRLRRVACSCPNC    561 - 630
REGEGRGSNEPGKKKQHICHIEGCGKVYGKTSHLRAHLRWHTGERPFICNWMFCGKRFTRSDELQRHRRT    631 - 700
HTGEKRFECPECSKRFMRSDHLSKHVKTHQNKKGGGTALAIVTSGELDSSVTEVLGSPRIVTVAAISQDS    701 - 770
NPATPNVSTNMEEF                                                            771 - 784
//

Text Mined References (42)

PMID Year Title
26431879 2015 O-GlcNAc modification of Sp3 and Sp4 transcription factors negatively regulates their transcriptional activities.
26049820 2015 Transcription factor SP4 phosphorylation is altered in the postmortem cerebellum of bipolar disorder and schizophrenia subjects.
25915526 2015 Phosphorylation of transcription factor specificity protein 4 is increased in peripheral blood mononuclear cells of first-episode psychosis.
25416956 2014 A proteome-scale map of the human interactome network.
25175639 2014 Increased SP4 and SP1 transcription factor expression in the postmortem hippocampus of chronic schizophrenia.
23941741 2013 Reduced expression of SP1 and SP4 transcription factors in peripheral blood mononuclear cells in first-episode psychosis.
23540600 2013 Analysis of Sp transcription factors in the postmortem brain of chronic schizophrenia: a pilot study of relationship to negative symptoms.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23103227 2012 Genetic variants at 6p21.1 and 7p15.3 are associated with risk of multiple cancers in Han Chinese.
22614877 2012 Genetics and expression analysis of the specificity protein 4 gene (SP4) in patients with Alzheimer's disease and frontotemporal lobar degeneration.
More...