Property Summary

NCBI Gene PubMed Count 77
Grant Count 139
R01 Count 94
Funding $15,088,958.47
PubMed Score 490.37
PubTator Score 403.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
esophageal adenocarcinoma -1.900 0.033
spina bifida -2.354 0.017
Breast cancer -2.300 0.000

Synonym

Accession Q02413 B7Z845
Symbols DG1
DSG
CDHF4
EPKHE
PPKS1
SPPK1
EPKHIA

Gene

PANTHER Protein Class (2)

Gene RIF (48)

PMID Text
26498522 Oxidized low-density lipoprotein attenuated desmoglein 1 and desmocollin 2 expression in human umbilical vein endothelial cells.
26169895 Desmoglein 1 mutation as cause of SAM syndrome
24594668 Ectopic expression of Dsg1 in keratinocyte monolayers rescued the UVB-induced differentiation defect
24220297 Desmoglein-1 regulates esophageal epithelial barrier function and immune responses in eosinophilic esophagitis.
23974871 DSG1 deficiency was associated with increased expression of a number of genes encoding allergy-related cytokines
23940119 The loss of Bcr or MAL reduced levels of Dsg1 mRNA in keratinocytes, and ectopic expression of Dsg1 rescued defects in differentiation seen upon loss of Bcr or MAL signaling.
23524970 DSG1 and Erbin cooperate to repress MAPK signaling and promote keratinocyte differentiation.
23489520 IgG autoantibodies against Dsg1 are mostly raised against preDsg1 and/or C-terminal domains of Dsg1 in healthy Tunisians in the endemic area of pemphigus foliaceus.
23297065 The data showed that serum autoantibodies of patients, previously identified as Dsg1 and Dsg3 positive, are able to recognize continuous linear epitope regions of both Dsg1 and Dsg3 proteins using pin-bound overlapping peptides in modified ELISAs.
22798673 we show that the LJM11 salivary protein from the sand fly are recognized by pemphigus foliaceus autoantibodies against desmoglein 1
More...

AA Sequence

MDWSFFRVVAMLFIFLVVVEVNSEFRIQVRDYNTKNGTIKWHSIRRQKREWIKFAAACREGEDNSKRNPI      1 - 70
AKIHSDCAANQQVTYRISGVGIDQPPYGIFVINQKTGEINITSIVDREVTPFFIIYCRALNSMGQDLERP     71 - 140
LELRVRVLDINDNPPVFSMATFAGQIEENSNANTLVMILNATDADEPNNLNSKIAFKIIRQEPSDSPMFI    141 - 210
INRNTGEIRTMNNFLDREQYGQYALAVRGSDRDGGADGMSAECECNIKILDVNDNIPYMEQSSYTIEIQE    211 - 280
NTLNSNLLEIRVIDLDEEFSANWMAVIFFISGNEGNWFEIEMNERTNVGILKVVKPLDYEAMQSLQLSIG    281 - 350
VRNKAEFHHSIMSQYKLKASAISVTVLNVIEGPVFRPGSKTYVVTGNMGSNDKVGDFVATDLDTGRPSTT    351 - 420
VRYVMGNNPADLLAVDSRTGKLTLKNKVTKEQYNMLGGKYQGTILSIDDNLQRTCTGTININIQSFGNDD    421 - 490
RTNTEPNTKITTNTGRQESTSSTNYDTSTTSTDSSQVYSSEPGNGAKDLLSDNVHFGPAGIGLLIMGFLV    491 - 560
LGLVPFLMICCDCGGAPRSAAGFEPVPECSDGAIHSWAVEGPQPEPRDITTVIPQIPPDNANIIECIDNS    561 - 630
GVYTNEYGGREMQDLGGGERMTGFELTEGVKTSGMPEICQEYSGTLRRNSMRECREGGLNMNFMESYFCQ    631 - 700
KAYAYADEDEGRPSNDCLLIYDIEGVGSPAGSVGCCSFIGEDLDDSFLDTLGPKFKKLADISLGKESYPD    701 - 770
LDPSWPPQSTEPVCLPQETEPVVSGHPPISPHFGTTTVISESTYPSGPGVLHPKPILDPLGYGNVTVTES    771 - 840
YTTSDTLKPSVHVHDNRPASNVVVTERVVGPISGADLHGMLEMPDLRDGSNVIVTERVIAPSSSLPTSLT    841 - 910
IHHPRESSNVVVTERVIQPTSGMIGSLSMHPELANAHNVIVTERVVSGAGVTGISGTTGISGGIGSSGLV    911 - 980
GTSMGAGSGALSGAGISGGGIGLSSLGGTASIGHMRSSSDHHFNQTIGSASPSTARSRITKYSTVQYSK     981 - 1049
//

Text Mined References (82)

PMID Year Title
26498522 2015 Oxidized low-density lipoprotein attenuated desmoglein 1 and desmocollin 2 expression via LOX-1/Ca(2+)/PKC-? signal in human umbilical vein endothelial cells.
26169895 2015 [Homozygous desmoglein 1 gene mutations and severe dermatitis, multiple allergies and metabolic wasting (SAM syndrome)].
25468811 2015 Expression of desmogleins 1-3 and their clinical impacts on human lung cancer.
25231147 2014 Heterogeneous and abnormal localization of desmosomal proteins in oral intraepithelial neoplasms.
25041099 2015 Loss of desmoglein 1 associated with palmoplantar keratoderma, dermatitis and multiple allergies.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24849508 2014 Aberrant expression and altered cellular localization of desmosomal and hemidesmosomal proteins are associated with aggressive clinicopathological features of oral squamous cell carcinoma.
24594668 2014 The desmosomal protein desmoglein 1 aids recovery of epidermal differentiation after acute UV light exposure.
24220297 2014 Desmoglein-1 regulates esophageal epithelial barrier function and immune responses in eosinophilic esophagitis.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
More...