Property Summary

NCBI Gene PubMed Count 48
PubMed Score 70.66
PubTator Score 124.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 1.6e-116
lung carcinoma 2843 6.0e-40
ovarian cancer 8520 1.1e-08
colon cancer 1478 3.0e-05
group 3 medulloblastoma 4104 5.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Colorectal cancer 25 3.841 1.9
Alzheimer's disease 658 3.44 1.7
Adenoma 167 3.127 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
colon cancer -1.400 3.0e-05
group 3 medulloblastoma -1.300 5.0e-03
lung carcinoma 1.500 6.0e-40
ovarian cancer 1.100 1.1e-08
psoriasis -1.300 1.6e-116

 GO Function (1)

Protein-protein Interaction (1)

Gene RIF (19)

AA Sequence

MNHLEGSAEVEVTDEAAGGEVNESVEADLEHPEVEEEQQQPPQQQHYVGRHQRGRALEDLRAQLGQEEEE      1 - 70
RGECLARSASTESGFHNHTDTAEGDVIAAARDGYDAERAQDPEDESAYAVQYRPEAEEYTEQAEAEHAEA     71 - 140
THRRALPNHLHFHSLEHEEAMNAAYSGYVYTHRLFHRGEDEPYSEPYADYGGLQEHVYEEIGDAPELDAR    141 - 210
DGLRLYEQERDEAAAYRQEALGARLHHYDERSDGESDSPEKEAEFAPYPRMDSYEQEEDIDQIVAEVKQS    211 - 280
MSSQSLDKAAEDMPEAEQDLERPPTPAGGRPDSPGLQAPAGQQRAVGPAGGGEAGQRYSKEKRDAISLAI    281 - 350
KDIKEAIEEVKTRTIRSPYTPDEPKEPIWVMRQDISPTRDCDDQRPMDGDSPSPGSSSPLGAESSSTSLH    351 - 420
PSDPVEASTNKESRKSLASFPTYVEVPGPCDPEDLIDGIIFAANYLGSTQLLSDKTPSKNVRMMQAQEAV    421 - 490
SRIKMAQKLAKSRKKAPEGESQPMTEVDLFISTQRIKVLNADTQETMMDHPLRTISYIADIGNIVVLMAR    491 - 560
RRMPRSNSQENVEASHPSQDGKRQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGINPEDLSQKE    561 - 630
YSDLLNTQDMYNDDLIHFSKSENCKDVFIEKQKGEILGVVIVESGWGSILPTVIIANMMHGGPAEKSGKL    631 - 700
NIGDQIMSINGTSLVGLPLSTCQSIIKGLKNQSRVKLNIVRCPPVTTVLIRRPDLRYQLGFSVQNGIICS    701 - 770
LMRGGIAERGGVRVGHRIIEINGQSVVATPHEKIVHILSNAVGEIHMKTMPAAMYRLLTAQEQPVYI       771 - 837
//

Text Mined References (50)

PMID Year Title