Property Summary

NCBI Gene PubMed Count 47
Grant Count 57
R01 Count 35
Funding $3,502,917.26
PubMed Score 75.44
PubTator Score 124.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
colon cancer -1.400 0.000
group 3 medulloblastoma -1.300 0.005
lung carcinoma 1.500 0.000
ovarian cancer 1.100 0.000
psoriasis -1.300 0.000

Synonym

Accession Q02410 O14914 O60570 Q5VYR8
Symbols X11
X11A
LIN10
MINT1
D9S411E
X11ALPHA

Gene

PDB

1X11   1AQC   1U37   1U38   1U39   1U3B   1X45   1Y7N  

 GO Function (1)

Gene RIF (18)

PMID Text
24742670 Mints are necessary for activity-induced APP and PS1 trafficking and provide insight into the cellular fate of APP in endocytic pathways essential for Abeta production.
23737971 Mint1 826 bridges APP to the small GTPase
22355143 an autoinhibitory mechanism in Mint1 is important for regulating APP processing and may provide novel therapies for Alzheimer's disease
21763699 Study identified the conserved binding site for the peptide on the CASK calmodulin kinase domain. A related EPIWVMRQ peptide from Mint1 was also discovered to be sufficient for binding.
21178287 Transcriptional co-activators Taz and Yap mediate signaling via the amyloid beta protein precursor paralogues APLP1 and APLP2 through interactions with Mint1 and Mint3.
20531236 Our findings show a new function for X11alpha that may impact on Alzheimer's disease pathogenesis.
20468060 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20160714 Methylation of MINT1 was significantly more prevalent in UC-CRC cases compared with controls.
20016085 A novel consensus sequence for interaction with the PDZ-1 and PDZ-2 domains of amyloid precursor protein (APP)-interacting proteins Mint1, Mint2, and Mint3 is reported, with multiple novel interactors for these proteins.
More...

AA Sequence

MNHLEGSAEVEVTDEAAGGEVNESVEADLEHPEVEEEQQQPPQQQHYVGRHQRGRALEDLRAQLGQEEEE      1 - 70
RGECLARSASTESGFHNHTDTAEGDVIAAARDGYDAERAQDPEDESAYAVQYRPEAEEYTEQAEAEHAEA     71 - 140
THRRALPNHLHFHSLEHEEAMNAAYSGYVYTHRLFHRGEDEPYSEPYADYGGLQEHVYEEIGDAPELDAR    141 - 210
DGLRLYEQERDEAAAYRQEALGARLHHYDERSDGESDSPEKEAEFAPYPRMDSYEQEEDIDQIVAEVKQS    211 - 280
MSSQSLDKAAEDMPEAEQDLERPPTPAGGRPDSPGLQAPAGQQRAVGPAGGGEAGQRYSKEKRDAISLAI    281 - 350
KDIKEAIEEVKTRTIRSPYTPDEPKEPIWVMRQDISPTRDCDDQRPMDGDSPSPGSSSPLGAESSSTSLH    351 - 420
PSDPVEASTNKESRKSLASFPTYVEVPGPCDPEDLIDGIIFAANYLGSTQLLSDKTPSKNVRMMQAQEAV    421 - 490
SRIKMAQKLAKSRKKAPEGESQPMTEVDLFISTQRIKVLNADTQETMMDHPLRTISYIADIGNIVVLMAR    491 - 560
RRMPRSNSQENVEASHPSQDGKRQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGINPEDLSQKE    561 - 630
YSDLLNTQDMYNDDLIHFSKSENCKDVFIEKQKGEILGVVIVESGWGSILPTVIIANMMHGGPAEKSGKL    631 - 700
NIGDQIMSINGTSLVGLPLSTCQSIIKGLKNQSRVKLNIVRCPPVTTVLIRRPDLRYQLGFSVQNGIICS    701 - 770
LMRGGIAERGGVRVGHRIIEINGQSVVATPHEKIVHILSNAVGEIHMKTMPAAMYRLLTAQEQPVYI       771 - 837
//

Text Mined References (49)

PMID Year Title
24742670 2014 Mint proteins are required for synaptic activity-dependent amyloid precursor protein (APP) trafficking and amyloid ? generation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23737971 2013 A new Mint1 isoform, but not the conventional Mint1, interacts with the small GTPase Rab6.
22355143 2012 Autoinhibition of Mint1 adaptor protein regulates amyloid precursor protein binding and processing.
21763699 2011 The molecular basis of the Caskin1 and Mint1 interaction with CASK.
21178287 2011 Signaling via amyloid precursor-like proteins APLP1 and APLP2.
20531236 2010 An X11alpha/FSBP complex represses transcription of the GSK3beta gene promoter.
20468060 2010 Genetic pathway-based hierarchical clustering analysis of older adults with cognitive complaints and amnestic mild cognitive impairment using clinical and neuroimaging phenotypes.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20160714 2010 Methylation status of genes in non-neoplastic mucosa from patients with ulcerative colitis-associated colorectal cancer.
More...