Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.10
PubTator Score 4.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -1.100 0.000
glioblastoma multiforme 1.100 0.000
osteosarcoma -1.599 0.000
ependymoma 1.100 0.000
sonic hedgehog group medulloblastoma 1.600 0.000
atypical teratoid/rhabdoid tumor 1.300 0.000
lung cancer 1.400 0.030
ovarian cancer -1.900 0.000

Synonym

Accession Q02386 P17016 P78472 Q9P1U9
Symbols KOX5
ZNF13

Gene

Gene RIF (1)

PMID Text
19195718 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MTKSKEAVTFKDVAVVFSEEELQLLDLAQRKLYRDVMLENFRNVVSVGHQSTPDGLPQLEREEKLWMMKM      1 - 70
ATQRDNSSGAKNLKEMETLQEVGLRYLPHEELFCSQIWQQITRELIKYQDSVVNIQRTGCQLEKRDDLHY     71 - 140
KDEGFSNQSSHLQVHRVHTGEKPYKGEHCVKSFSWSSHLQINQRAHAGEKPYKCEKCDNAFRRFSSLQAH    141 - 210
QRVHSRAKSYTNDASYRSFSQRSHLPHHQRVPTGENPYKYEECGRNVGKSSHCQAPLIVHTGEKPYKCEE    211 - 280
CGVGFSQRSYLQVHLKVHTGKKPYKCEECGKSFSWRSRLQAHERIHTGEKPYKCNACGKSFSYSSHLNIH    281 - 350
CRIHTGEKPYKCEECGKGFSVGSHLQAHQISHTGEKPYKCEECGKGFCRASNLLDHQRGHTGEKPYQCDA    351 - 420
CGKGFSRSSDFNIHFRVHTGEKPYKCEECGKGFSQASNLLAHQRGHTGEKPYKCGTCGKGFSRSSDLNVH    421 - 490
CRIHTGEKPYKCERCGKAFSQFSSLQVHQRVHTGEKPYQCAECGKGFSVGSQLQAHQRCHTGEKPYQCEE    491 - 560
CGKGFCRASNFLAHRGVHTGEKPYRCDVCGKRFRQRSYLQAHQRVHTGERPYKCEECGKVFSWSSYLQAH    561 - 630
QRVHTGEKPYKCEECGKGFSWSSSLIIHQRVHADDEGDKDFPSSEDSHRKTR                      631 - 682
//

Text Mined References (9)

PMID Year Title
25003214 2014 The correlation between reading and mathematics ability at age twelve has a substantial genetic component.
19195718 2009 A follow-up study of chromosome 19q13 in multiple sclerosis susceptibility.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9570955 1998 Analysis of homologous XRCC1-linked zinc-finger gene families in human and mouse: evidence for orthologous genes.
9067431 1996 Complete coding sequence, exon/intron arrangement and chromosome location of ZNF45, a KRAB-domain-containing gene.
2288909 1990 Multiple genes encoding zinc finger domains are expressed in human T cells.
1559709 1992 The identification and characterization of KRAB-domain-containing zinc finger proteins.