Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.10
PubTator Score 4.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
glioblastoma multiforme 347 1.32090891346862E-15
psoriasis 6685 6.67444433953597E-8
ovarian cancer 8492 2.74684797842934E-7
ependymoma 2514 6.49652006308155E-6
osteosarcoma 7933 1.47223248766338E-5
sonic hedgehog group medulloblastoma 1482 3.19158387436136E-5
atypical teratoid/rhabdoid tumor 1095 1.05989455259207E-4
lung cancer 4473 0.0295786755879483

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -1.100 0.000
glioblastoma multiforme 1.100 0.000
osteosarcoma -1.599 0.000
ependymoma 1.100 0.000
sonic hedgehog group medulloblastoma 1.600 0.000
atypical teratoid/rhabdoid tumor 1.300 0.000
lung cancer 1.400 0.030
ovarian cancer -1.900 0.000

Synonym

Accession Q02386 P17016 P78472 Q9P1U9
Symbols KOX5
ZNF13

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG
Rat OMA EggNOG
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid

Gene RIF (1)

PMID Text
19195718 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MTKSKEAVTFKDVAVVFSEEELQLLDLAQRKLYRDVMLENFRNVVSVGHQSTPDGLPQLEREEKLWMMKM      1 - 70
ATQRDNSSGAKNLKEMETLQEVGLRYLPHEELFCSQIWQQITRELIKYQDSVVNIQRTGCQLEKRDDLHY     71 - 140
KDEGFSNQSSHLQVHRVHTGEKPYKGEHCVKSFSWSSHLQINQRAHAGEKPYKCEKCDNAFRRFSSLQAH    141 - 210
QRVHSRAKSYTNDASYRSFSQRSHLPHHQRVPTGENPYKYEECGRNVGKSSHCQAPLIVHTGEKPYKCEE    211 - 280
CGVGFSQRSYLQVHLKVHTGKKPYKCEECGKSFSWRSRLQAHERIHTGEKPYKCNACGKSFSYSSHLNIH    281 - 350
CRIHTGEKPYKCEECGKGFSVGSHLQAHQISHTGEKPYKCEECGKGFCRASNLLDHQRGHTGEKPYQCDA    351 - 420
CGKGFSRSSDFNIHFRVHTGEKPYKCEECGKGFSQASNLLAHQRGHTGEKPYKCGTCGKGFSRSSDLNVH    421 - 490
CRIHTGEKPYKCERCGKAFSQFSSLQVHQRVHTGEKPYQCAECGKGFSVGSQLQAHQRCHTGEKPYQCEE    491 - 560
CGKGFCRASNFLAHRGVHTGEKPYRCDVCGKRFRQRSYLQAHQRVHTGERPYKCEECGKVFSWSSYLQAH    561 - 630
QRVHTGEKPYKCEECGKGFSWSSSLIIHQRVHADDEGDKDFPSSEDSHRKTR                      631 - 682
//

Text Mined References (9)

PMID Year Title
25003214 2014 The correlation between reading and mathematics ability at age twelve has a substantial genetic component.
19195718 2009 A follow-up study of chromosome 19q13 in multiple sclerosis susceptibility.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9570955 1998 Analysis of homologous XRCC1-linked zinc-finger gene families in human and mouse: evidence for orthologous genes.
9067431 1996 Complete coding sequence, exon/intron arrangement and chromosome location of ZNF45, a KRAB-domain-containing gene.
2288909 1990 Multiple genes encoding zinc finger domains are expressed in human T cells.
1559709 1992 The identification and characterization of KRAB-domain-containing zinc finger proteins.