Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.10
PubTator Score 4.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 6.7e-08
ovarian cancer 8519 2.7e-07
ependymoma 4679 6.5e-06
osteosarcoma 7950 1.5e-05
atypical teratoid / rhabdoid tumor 5112 1.0e-03
glioblastoma 5792 1.1e-03
group 3 medulloblastoma 4104 4.5e-03
lung cancer 4740 3.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 1.0e-03
ependymoma 1.100 6.5e-06
glioblastoma 1.100 1.1e-03
group 3 medulloblastoma 1.400 4.5e-03
lung cancer 1.400 3.0e-02
osteosarcoma -1.599 1.5e-05
ovarian cancer -1.900 2.7e-07
psoriasis -1.100 6.7e-08

Gene RIF (1)

AA Sequence

MTKSKEAVTFKDVAVVFSEEELQLLDLAQRKLYRDVMLENFRNVVSVGHQSTPDGLPQLEREEKLWMMKM      1 - 70
ATQRDNSSGAKNLKEMETLQEVGLRYLPHEELFCSQIWQQITRELIKYQDSVVNIQRTGCQLEKRDDLHY     71 - 140
KDEGFSNQSSHLQVHRVHTGEKPYKGEHCVKSFSWSSHLQINQRAHAGEKPYKCEKCDNAFRRFSSLQAH    141 - 210
QRVHSRAKSYTNDASYRSFSQRSHLPHHQRVPTGENPYKYEECGRNVGKSSHCQAPLIVHTGEKPYKCEE    211 - 280
CGVGFSQRSYLQVHLKVHTGKKPYKCEECGKSFSWRSRLQAHERIHTGEKPYKCNACGKSFSYSSHLNIH    281 - 350
CRIHTGEKPYKCEECGKGFSVGSHLQAHQISHTGEKPYKCEECGKGFCRASNLLDHQRGHTGEKPYQCDA    351 - 420
CGKGFSRSSDFNIHFRVHTGEKPYKCEECGKGFSQASNLLAHQRGHTGEKPYKCGTCGKGFSRSSDLNVH    421 - 490
CRIHTGEKPYKCERCGKAFSQFSSLQVHQRVHTGEKPYQCAECGKGFSVGSQLQAHQRCHTGEKPYQCEE    491 - 560
CGKGFCRASNFLAHRGVHTGEKPYRCDVCGKRFRQRSYLQAHQRVHTGERPYKCEECGKVFSWSSYLQAH    561 - 630
QRVHTGEKPYKCEECGKGFSWSSSLIIHQRVHADDEGDKDFPSSEDSHRKTR                      631 - 682
//

Text Mined References (10)

PMID Year Title