Property Summary

NCBI Gene PubMed Count 28
PubMed Score 9.88
PubTator Score 51.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Varicocele 21 3.287 1.6
psoriasis 6,685

Synonym

Accession Q02383 Q53ZU2 Q6X2M5 Q6X2M6
Symbols SGII

Gene

Gene RIF (11)

PMID Text
25631074 Cellular biotinylated semenogelin II protein (SEMG2) is incorporated into HIV-1 Gag virus-like particles
22177559 Peptides released by physiological cleavage of Semg1 and Semg2 form amyloids that enhance HIV infection.
21557275 These results suggest the involvement of semenogelins in prostate cancer and their prognostic values in predicting cancer progression after radical prostatectomy.
19089943 Semenogelins (Sgs) modifies the membrane structure, indirectly inhibiting motility, and provides suggestions for a therapy for male infertility through selection of a functional sperm population using Sgs.
18714013 antibacterial activity of the semenogelin-derived peptides generated in seminal plasma was strictly zinc-dependent both at neutral and low pH
18482984 semenogelins I and II were directly cleaved by KLK14. Semenogelins were also able to reverse KLK14 inhibition by Zn2+, providing a novel regulatory mechanism for KLK14 activity.
17683036 SGII is a novel target for protein S-nitrosylation in spermatozoa.
15563730 The binding of Zn2+ to SgI and SgII and their involvment in regulating the activity of PSA are reported.
14629036 structural changes in the semenogelin 1 and 2 proteins that have arisen since the human-chimpanzee-gorilla split may be responsible for the physiological differences between these species ejaculated semen that correlate with their sociosexual behavior
14581514 Seminal plasma motility inhibitor, one of the fragments of Sg, has its inhibitory effect on ejaculated spermatozoa in liquefied semen under physiological conditions.
More...

AA Sequence

MKSIILFVLSLLLILEKQAAVMGQKGGSKGQLPSGSSQFPHGQKGQHYFGQKDQQHTKSKGSFSIQHTYH      1 - 70
VDINDHDWTRKSQQYDLNALHKATKSKQHLGGSQQLLNYKQEGRDHDKSKGHFHMIVIHHKGGQAHHGTQ     71 - 140
NPSQDQGNSPSGKGLSSQCSNTEKRLWVHGLSKEQASASGAQKGRTQGGSQSSYVLQTEELVVNKQQRET    141 - 210
KNSHQNKGHYQNVVDVREEHSSKLQTSLHPAHQDRLQHGPKDIFTTQDELLVYNKNQHQTKNLSQDQEHG    211 - 280
RKAHKISYPSSRTEERQLHHGEKSVQKDVSKGSISIQTEEKIHGKSQNQVTIHSQDQEHGHKENKISYQS    281 - 350
SSTEERHLNCGEKGIQKGVSKGSISIQTEEQIHGKSQNQVRIPSQAQEYGHKENKISYQSSSTEERRLNS    351 - 420
GEKDVQKGVSKGSISIQTEEKIHGKSQNQVTIPSQDQEHGHKENKMSYQSSSTEERRLNYGGKSTQKDVS    421 - 490
QSSISFQIEKLVEGKSQIQTPNPNQDQWSGQNAKGKSGQSADSKQDLLSHEQKGRYKQESSESHNIVITE    491 - 560
HEVAQDDHLTQQYNEDRNPIST                                                    561 - 582
//

Text Mined References (28)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22177559 2011 Peptides released by physiological cleavage of semen coagulum proteins form amyloids that enhance HIV infection.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21557275 2011 Expression of semenogelins I and II and its prognostic significance in human prostate cancer.
19089943 2009 Functional implications of membrane modification with semenogelins for inhibition of sperm motility in humans.
18714013 2008 The major bactericidal activity of human seminal plasma is zinc-dependent and derived from fragmentation of the semenogelins.
18482984 2008 Major role of human KLK14 in seminal clot liquefaction.
17683036 2007 Human spermatozoa contain multiple targets for protein S-nitrosylation: an alternative mechanism of the modulation of sperm function by nitric oxide?
15563730 2005 Semenogelins I and II bind zinc and regulate the activity of prostate-specific antigen.
15531881 2004 Rate of molecular evolution of the seminal protein gene SEMG2 correlates with levels of female promiscuity.
More...