Property Summary

NCBI Gene PubMed Count 124
PubMed Score 307.16
PubTator Score 234.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
acute quadriplegic myopathy 1.222 2.4e-04
astrocytoma 1.500 7.5e-03
autosomal dominant Emery-Dreifuss muscul... 1.302 3.3e-03
chronic lymphosyte leukemia -2.700 3.7e-09
colon cancer -1.500 2.8e-03
cystic fibrosis 1.199 8.8e-04
Duchenne muscular dystrophy 1.215 9.4e-07
esophageal adenocarcinoma 1.400 2.5e-02
glioblastoma 1.200 9.3e-03
group 3 medulloblastoma -2.100 7.5e-04
invasive ductal carcinoma 1.100 1.0e-02
juvenile dermatomyositis 1.500 4.4e-10
lung adenocarcinoma -1.208 7.8e-04
malignant mesothelioma -4.800 1.4e-09
medulloblastoma, large-cell -3.600 2.2e-07
mucosa-associated lymphoid tissue lympho... 1.271 3.3e-02
nasopharyngeal carcinoma 1.200 5.0e-05
non-small cell lung cancer -1.586 8.3e-22
oligodendroglioma 2.200 3.7e-02
osteosarcoma 1.582 4.6e-06
ovarian cancer -2.400 6.9e-06
pituitary cancer -1.800 6.0e-04
posterior fossa group A ependymoma 1.200 1.5e-02
primary pancreatic ductal adenocarcinoma 1.116 2.6e-02
psoriasis -1.100 6.0e-05
Waldenstrons macroglobulinemia -1.702 3.7e-02

Gene RIF (89)

AA Sequence

MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVID      1 - 70
YILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG           71 - 134
//

Text Mined References (126)

PMID Year Title