Property Summary

NCBI Gene PubMed Count 114
Grant Count 222
R01 Count 128
Funding $18,284,826.31
PubMed Score 294.48
PubTator Score 234.34

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q02363
Symbols GIG8
ID2A
ID2H
bHLHb26

Gene

ID2

PANTHER Protein Class (1)

PDB

4AYA  

 GO Function (1)

Gene RIF (80)

PMID Text
26735018 ID2 binds to the VHL ubiquitin ligase complex, displaces VHL-associated Cullin 2, and impairs HIF2alpha ubiquitylation and degradation
25778840 Inhibitor of differentiation 4 (ID4) acts as an inhibitor of ID-1, -2 and -3 and promotes basic helix loop helix (bHLH) E47 DNA binding and transcriptional activity.
25773386 Downregulation of the Id2 gene by RNAi could increase the chemosensitivity of glioblastoma cells. Id2 could be a good molecular target for glioblastoma gene therapy.
25771836 High Id2 expression is associated with Neuroblatoma.
25076250 ID2 was involved in cancer cell responses to Arsenic Tri-Oxide (ATO). Increased expression of ID2 was found in cancer cells following ATO treatment. In addition, specific silencing of ID2 enhanced cell apoptosis induced by ATO treatment.
24425046 Id2 overexpression in neural stem cells is associated with inhibition of the Notch effector Hey1 and glioma formation in the brains of mice.
24376712 role of Id2-TGFbeta crosstalk in reversible adaptive plasticity in neuroblastoma
24343358 study shows that Id2, Id3 and Id4 are each able to overcome TGF-beta dependence, and establish a role for Ids as key mediators of TGF-beta melanomagenesis
24292846 Importantly, the distinct ID2 expression patterns in acute leukemias (AL) indicate a specific deregulation of ID2 in the various types of AL and may support subtyping of AL.
23825313 PreBII large cells in adults, but not in children, showed highly upregulated expression of the differentiation inhibitor, inhibitor of DNA binding 2 (ID2), in absence of changes in expression of the ID2-binding partner E2A.
More...

AA Sequence

MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVID      1 - 70
YILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG           71 - 134
//

Text Mined References (116)

PMID Year Title
26735018 2016 An ID2-dependent mechanism for VHL inactivation in cancer.
25778840 2015 Inhibitor of differentiation 4 (ID4) acts as an inhibitor of ID-1, -2 and -3 and promotes basic helix loop helix (bHLH) E47 DNA binding and transcriptional activity.
25773386 2015 Downregulation of Id2 increases chemosensitivity of glioma.
25771836 2015 The Role of Id2 Protein in Neuroblatoma in Children.
25076250 Upregulation of ID2 antagonizes arsenic trioxide-induced antitumor effects in cancer cells.
24425046 2014 Id2 mediates oligodendrocyte precursor cell maturation arrest and is tumorigenic in a PDGF-rich microenvironment.
24376712 2013 A mechanism linking Id2-TGF? crosstalk to reversible adaptive plasticity in neuroblastoma.
24343358 2014 Id2, Id3 and Id4 overcome a Smad7-mediated block in tumorigenesis, generating TGF-?-independent melanoma.
24292846 2014 ID2 and ID3 protein expression mirrors granulopoietic maturation and discriminates between acute leukemia subtypes.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...