Property Summary

NCBI Gene PubMed Count 15
PubMed Score 41.39
PubTator Score 48.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Gene RIF (2)

AA Sequence

MLATRLSRPLSRLPGKTLSACDRENGARRPLLLGSTSFIPIGRRTYASAAEPVGSKAVLVTGCDSGFGFS      1 - 70
LAKHLHSKGFLVFAGCLMKDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKVVEIVRSSLKDPEKGMWG     71 - 140
LVNNAGISTFGEVEFTSLETYKQVAEVNLWGTVRMTKSFLPLIRRAKGRVVNISSMLGRMANPARSPYCI    141 - 210
TKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESIQAIAKKMWEELPEVVRKDYGKKYFDEK    211 - 280
IAKMETYCSSGSTDTSPVIDAVTHALTATTPYTRYHPMDYYWWLRMQIMTHLPGAISDMIYIR           281 - 343
//

Text Mined References (17)

PMID Year Title