Property Summary

NCBI Gene PubMed Count 409
Grant Count 540
R01 Count 264
Funding $62,677,623.4
PubMed Score 843.84
PubTator Score 761.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
nephrosclerosis -1.036 0.039
pancreatic cancer 1.100 0.023
malignant mesothelioma 2.100 0.000
astrocytic glioma -2.000 0.003
posterior fossa group A ependymoma -2.200 0.000
oligodendroglioma -1.500 0.009
osteosarcoma -1.817 0.000
glioblastoma -2.600 0.001
type II diabetes mellitus and post-ische... 1.200 0.028
atypical teratoid / rhabdoid tumor 1.100 0.026
group 4 medulloblastoma -2.200 0.000
medulloblastoma, large-cell -2.000 0.020
tuberculosis 1.900 0.000
colon cancer -1.200 0.027
lung cancer -2.400 0.000
interstitial cystitis 1.800 0.008
lung adenocarcinoma -1.500 0.000
pediatric high grade glioma -2.100 0.001
pilocytic astrocytoma -3.000 0.000
pancreatic carcinoma 1.100 0.023
Breast cancer -2.800 0.000
pituitary cancer 2.000 0.000

Synonym

Gene

PANTHER Protein Class (2)

PDB

1HAE   1HAF   1HRE   1HRF   3U7U  

Gene RIF (397)

PMID Text
27110055 Study shows that Neuregulin did not perform successfully as a biomarker for acute myocardial infarction or acute coronary syndrome in the emergency department.
26891847 This study demonstrate dysregulation of the NRG1-ErbB4/3 axis in both human and mouse ALS and to provide support for NRG1 supplementation as a possible therapeutic option for motor neuron disease
26886748 while transcript and protein levels of EGFR and ErbB2 were up-regulated or unaffected, respectively, hepatitis c virus induced a substantial reduction of ErbB3 and ErbB4 expression.
26780728 In this study, we developed an anti-ErbB4 mAb (clone P6-1) that suppresses NRG-dependent activation of ErbB4 and examined its effect on breast cancer cell proliferation in the extracellular matrix.
26648299 NRG1 promotes the proliferation and migration of coronary artery smooth muscle cells by enhancing the phosphorylation of ErbB2, ErbB3 and ErbB4.
26588216 Genome sequencing revealed that all but one of the filamentous isolates harbored mutations in the transcriptional repressor NRG1; such mutations were necessary and sufficient for the filamentous phenotype
26535009 Neuregulin-activated ERBB4 induces the SREBP-2 cholesterol biosynthetic pathway and increases low-density lipoprotein uptake.
26534905 Polymorphisms of dopamine pathway gene NRG1 is associated with cognitive performance in Bipolar disorder.
26490994 findings newly identify a physiological function of the NRG1-ErbB2-ErbB3 axis in trophoblast survival during human placental development.
26327598 Data indicate telomere-binding protein RAP1 as an interacting partner of isoform beta2 of the heregulin (HRGbeta2).
More...

AA Sequence

MSERKEGRGKGKGKKKERGSGKKPESAAGSQSPALPPRLKEMKSQESAAGSKLVLRCETSSEYSSLRFKW      1 - 70
FKNGNELNRKNKPQNIKIQKKPGKSELRINKASLADSGEYMCKVISKLGNDSASANITIVESNEIITGMP     71 - 140
ASTEGAYVSSESPIRISVSTEGANTSSSTSTSTTGTSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLC    141 - 210
KCQPGFTGARCTENVPMKVQNQEKAEELYQKRVLTITGICIALLVVGIMCVVAYCKTKKQRKKLHDRLRQ    211 - 280
SLRSERNNMMNIANGPHHPNPPPENVQLVNQYVSKNVISSEHIVEREAETSFSTSHYTSTAHHSTTVTQT    281 - 350
PSHSWSNGHTESILSESHSVIVMSSVENSRHSSPTGGPRGRLNGTGGPRECNSFLRHARETPDSYRDSPH    351 - 420
SERYVSAMTTPARMSPVDFHTPSSPKSPPSEMSPPVSSMTVSMPSMAVSPFMEEERPLLLVTPPRLREKK    421 - 490
FDHHPQQFSSFHHNPAHDSNSLPASPLRIVEDEEYETTQEYEPAQEPVKKLANSRRAKRTKPNGHIANRL    491 - 560
EVDSNTSSQSSNSESETEDERVGEDTPFLGIQNPLAASLEATPAFRLADSRTNPAGRFSTQEEIQARLSS    561 - 630
VIANQDPIAV                                                                631 - 640
//

Text Mined References (412)

PMID Year Title
27110055 2016 Diagnostic Utility of Neuregulin for Acute Coronary Syndrome.
27027665 2016 Gene aberrations for precision medicine against lung adenocarcinoma.
26993800 2016 Neuregulin-1 controls an endogenous repair mechanism after spinal cord injury.
26960157 2016 Antipsychotic Drugs Differentially Affect mRNA Expression of Genes Encoding the Neuregulin 1-Downstream ErbB4-PI3K Pathway.
26909665 2016 Effects of NRG1 genotypes on orbitofrontal sulcogyral patterns in Japanese patients diagnosed with schizophrenia.
26891847 2016 Neuregulin 1 confers neuroprotection in SOD1-linked amyotrophic lateral sclerosis mice via restoration of C-boutons of spinal motor neurons.
26886748 2016 Hepatitis C Virus Activates a Neuregulin-Driven Circuit to Modify Surface Expression of Growth Factor Receptors of the ErbB Family.
26780728 2016 Development of an ErbB4 monoclonal antibody that blocks neuregulin-1-induced ErbB4 activation in cancer cells.
26648299 2015 [Neuregulin-1 promotes proliferation and migration of human coronary artery smooth muscle cells by enhancing its receptor phosphorylation].
26588216 2015 Global Analysis of the Fungal Microbiome in Cystic Fibrosis Patients Reveals Loss of Function of the Transcriptional Repressor Nrg1 as a Mechanism of Pathogen Adaptation.
More...