Property Summary

NCBI Gene PubMed Count 36
PubMed Score 384.50
PubTator Score 1014.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
psoriasis 6685 2.39447337534648E-79
atypical teratoid/rhabdoid tumor 1095 5.78761144630944E-8
oligodendroglioma 2849 2.52256369658711E-6
group 4 medulloblastoma 1875 4.03943745333793E-6
pituitary cancer 1972 1.15853101858362E-5
ependymoma 2514 1.23633988104088E-5
pediatric high grade glioma 2712 1.41223941653212E-4
pilocytic astrocytoma 3086 4.33766719421951E-4
glioblastoma 5572 7.75369468872513E-4
subependymal giant cell astrocytoma 2287 0.00116717811879669
astrocytic glioma 2241 0.0458134270784274
Disease Target Count Z-score Confidence
Epilepsy 346 0.0 4.0

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -2.400 0.046
glioblastoma -1.900 0.001
oligodendroglioma -1.700 0.000
ependymoma -2.600 0.000
group 4 medulloblastoma -3.900 0.000
atypical teratoid/rhabdoid tumor -3.900 0.000
pediatric high grade glioma -2.500 0.000
pilocytic astrocytoma -2.000 0.000
subependymal giant cell astrocytoma -4.597 0.001
pituitary cancer -1.700 0.000
psoriasis -1.800 0.000

Synonym

Accession Q02246 P78432 Q5T054
Symbols AXT
TAX
TAX1
FAME5
TAG-1

Gene

PDB

2OM5  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (12)

PMID Text
26718491 RACK1 interacts with CNTN2, and the effects of RACK1 on glioma cell growth and differentiation are mediated by CNTN2.
24405708 Our results clearly demonstrate that mouse and human contactin-2 are physiological substrates for BACE1
23518707 A single nucleotide deletion in exon 6 of CNTN2 results in a frameshift mutation, segregating in a recessive manner in a consanguineous Egyptian family with epilepsy.
22462668 The single-nucleotide polymorphism (SNP) rs2275697 in the TAG-) gene was not associated with treatment responsiveness, treatment dependence, disability, or mortality in chronic inflammatory demyelinating polyneuropathy
22003931 allelic variation in TAG-1 does not play a major role in determining multifocal motor neuropathy susceptibility.
21696500 single nucleotide polymorphisms in TAG-1 are related to the IVIg responsiveness of Chronic inflammatory demyelinating polyneuropathy patients.
19776380 Observational study of gene-disease association. (HuGE Navigator)
19451620 immune response to CNTN2 and possible involvement in multiple sclerosis and EAE [REVIEW]
19416878 Contactin-2 is expressed by various neuronal populations and sequestered in the juxtaparanodal domain of myelinated axons both at the axonal and myelin sides; is an autoantigen targeted by T cells and autoantibodies in MS.
19086053 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MGTATRRKPHLLLVAAVALVSSSAWSSALGSQTTFGPVFEDQPLSVLFPEESTEEQVLLACRARASPPAT      1 - 70
YRWKMNGTEMKLEPGSRHQLVGGNLVIMNPTKAQDAGVYQCLASNPVGTVVSREAILRFGFLQEFSKEER     71 - 140
DPVKAHEGWGVMLPCNPPAHYPGLSYRWLLNEFPNFIPTDGRHFVSQTTGNLYIARTNASDLGNYSCLAT    141 - 210
SHMDFSTKSVFSKFAQLNLAAEDTRLFAPSIKARFPAETYALVGQQVTLECFAFGNPVPRIKWRKVDGSL    211 - 280
SPQWTTAEPTLQIPSVSFEDEGTYECEAENSKGRDTVQGRIIVQAQPEWLKVISDTEADIGSNLRWGCAA    281 - 350
AGKPRPTVRWLRNGEPLASQNRVEVLAGDLRFSKLSLEDSGMYQCVAENKHGTIYASAELAVQALAPDFR    351 - 420
LNPVRRLIPAARGGEILIPCQPRAAPKAVVLWSKGTEILVNSSRVTVTPDGTLIIRNISRSDEGKYTCFA    421 - 490
ENFMGKANSTGILSVRDATKITLAPSSADINLGDNLTLQCHASHDPTMDLTFTWTLDDFPIDFDKPGGHY    491 - 560
RRTNVKETIGDLTILNAQLRHGGKYTCMAQTVVDSASKEATVLVRGPPGPPGGVVVRDIGDTTIQLSWSR    561 - 630
GFDNHSPIAKYTLQARTPPAGKWKQVRTNPANIEGNAETAQVLGLTPWMDYEFRVIASNILGTGEPSGPS    631 - 700
SKIRTREAAPSVAPSGLSGGGGAPGELIVNWTPMSREYQNGDGFGYLLSFRRQGSTHWQTARVPGADAQY    701 - 770
FVYSNESVRPYTPFEVKIRSYNRRGDGPESLTALVYSAEEEPRVAPTKVWAKGVSSSEMNVTWEPVQQDM    771 - 840
NGILLGYEIRYWKAGDKEAAADRVRTAGLDTSARVSGLHPNTKYHVTVRAYNRAGTGPASPSANATTMKP    841 - 910
PPRRPPGNISWTFSSSSLSIKWDPVVPFRNESAVTGYKMLYQNDLHLTPTLHLTGKNWIEIPVPEDIGHA    911 - 980
LVQIRTTGPGGDGIPAEVHIVRNGGTSMMVENMAVRPAPHPGTVISHSVAMLILIGSLEL              981 - 1040
//

Text Mined References (36)

PMID Year Title
27621318 2016 Molecular Architecture of Contactin-associated Protein-like 2 (CNTNAP2) and Its Interaction with Contactin 2 (CNTN2).
26718491 2016 RACK1 affects glioma cell growth and differentiation through the CNTN2-mediated RTK/Ras/MAPK pathway.
24405708 2014 BACE1 activity regulates cell surface contactin-2 levels.
24026423 2014 A genome- and phenome-wide association study to identify genetic variants influencing platelet count and volume and their pleiotropic effects.
23518707 2013 Autosomal recessive cortical myoclonic tremor and epilepsy: association with a mutation in the potassium channel associated gene CNTN2.
22462668 2012 Single-nucleotide polymorphism of transient axonal glycoprotein-1 and its correlation with clinical features and prognosis in chronic inflammatory demyelinating polyneuropathy.
22003931 2011 Multifocal motor neuropathy is not associated with genetic variation in PTPN22, BANK1, Blk, FCGR2B, CD1A/E, and TAG-1 genes.
21696500 2011 Polymorphism of transient axonal glycoprotein-1 in chronic inflammatory demyelinating polyneuropathy.
19776380 2009 Single nucleotide polymorphism of TAG-1 influences IVIg responsiveness of Japanese patients with CIDP.
19451620 2009 The gray aspects of white matter disease in multiple sclerosis.
More...