Property Summary

NCBI Gene PubMed Count 36
PubMed Score 404.05
PubTator Score 1014.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -2.500 2.9e-03
astrocytic glioma -2.400 4.6e-02
Astrocytoma, Pilocytic -2.000 4.5e-04
atypical teratoid / rhabdoid tumor -1.100 1.7e-05
ependymoma -1.100 4.8e-06
glioblastoma -1.900 7.8e-04
group 3 medulloblastoma -1.500 2.2e-03
oligodendroglioma -1.700 2.5e-06
pituitary cancer -1.700 1.2e-05
psoriasis -1.800 2.4e-79
subependymal giant cell astrocytoma -1.815 1.7e-03

Gene RIF (13)

AA Sequence

MGTATRRKPHLLLVAAVALVSSSAWSSALGSQTTFGPVFEDQPLSVLFPEESTEEQVLLACRARASPPAT      1 - 70
YRWKMNGTEMKLEPGSRHQLVGGNLVIMNPTKAQDAGVYQCLASNPVGTVVSREAILRFGFLQEFSKEER     71 - 140
DPVKAHEGWGVMLPCNPPAHYPGLSYRWLLNEFPNFIPTDGRHFVSQTTGNLYIARTNASDLGNYSCLAT    141 - 210
SHMDFSTKSVFSKFAQLNLAAEDTRLFAPSIKARFPAETYALVGQQVTLECFAFGNPVPRIKWRKVDGSL    211 - 280
SPQWTTAEPTLQIPSVSFEDEGTYECEAENSKGRDTVQGRIIVQAQPEWLKVISDTEADIGSNLRWGCAA    281 - 350
AGKPRPTVRWLRNGEPLASQNRVEVLAGDLRFSKLSLEDSGMYQCVAENKHGTIYASAELAVQALAPDFR    351 - 420
LNPVRRLIPAARGGEILIPCQPRAAPKAVVLWSKGTEILVNSSRVTVTPDGTLIIRNISRSDEGKYTCFA    421 - 490
ENFMGKANSTGILSVRDATKITLAPSSADINLGDNLTLQCHASHDPTMDLTFTWTLDDFPIDFDKPGGHY    491 - 560
RRTNVKETIGDLTILNAQLRHGGKYTCMAQTVVDSASKEATVLVRGPPGPPGGVVVRDIGDTTIQLSWSR    561 - 630
GFDNHSPIAKYTLQARTPPAGKWKQVRTNPANIEGNAETAQVLGLTPWMDYEFRVIASNILGTGEPSGPS    631 - 700
SKIRTREAAPSVAPSGLSGGGGAPGELIVNWTPMSREYQNGDGFGYLLSFRRQGSTHWQTARVPGADAQY    701 - 770
FVYSNESVRPYTPFEVKIRSYNRRGDGPESLTALVYSAEEEPRVAPTKVWAKGVSSSEMNVTWEPVQQDM    771 - 840
NGILLGYEIRYWKAGDKEAAADRVRTAGLDTSARVSGLHPNTKYHVTVRAYNRAGTGPASPSANATTMKP    841 - 910
PPRRPPGNISWTFSSSSLSIKWDPVVPFRNESAVTGYKMLYQNDLHLTPTLHLTGKNWIEIPVPEDIGHA    911 - 980
LVQIRTTGPGGDGIPAEVHIVRNGGTSMMVENMAVRPAPHPGTVISHSVAMLILIGSLEL              981 - 1040
//

Text Mined References (36)

PMID Year Title