Property Summary

NCBI Gene PubMed Count 57
PubMed Score 96.59
PubTator Score 80.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
adrenocortical carcinoma 1.825 2.9e-03
adult high grade glioma 1.800 4.2e-04
Atopic dermatitis 1.900 9.6e-05
atypical teratoid / rhabdoid tumor 3.400 7.7e-10
Breast cancer 2.400 7.3e-14
breast carcinoma 1.500 7.7e-05
ductal carcinoma in situ 2.000 1.7e-03
Endometriosis 1.456 1.9e-02
ependymoma 1.200 1.4e-04
glioblastoma 2.400 1.8e-07
group 3 medulloblastoma 2.600 2.7e-06
intraductal papillary-mucinous carcinoma... 1.300 4.6e-03
intraductal papillary-mucinous neoplasm ... 2.800 7.6e-05
invasive ductal carcinoma 2.500 4.3e-05
lung cancer 1.600 3.0e-04
malignant mesothelioma 1.100 1.8e-04
medulloblastoma, large-cell 3.300 6.0e-07
nasopharyngeal carcinoma 2.000 4.5e-05
non-small cell lung cancer 2.721 2.7e-25
ovarian cancer 2.000 2.6e-04
pancreatic cancer 1.100 9.3e-05
primitive neuroectodermal tumor 3.100 4.3e-05
psoriasis 1.500 2.9e-04

Protein-protein Interaction (1)

Gene RIF (20)

AA Sequence

MKSARAKTPRKPTVKKGSQTNLKDPVGVYCRVRPLGFPDQECCIEVINNTTVQLHTPEGYRLNRNGDYKE      1 - 70
TQYSFKQVFGTHTTQKELFDVVANPLVNDLIHGKNGLLFTYGVTGSGKTHTMTGSPGEGGLLPRCLDMIF     71 - 140
NSIGSFQAKRYVFKSNDRNSMDIQCEVDALLERQKREAMPNPKTSSSKRQVDPEFADMITVQEFCKAEEV    141 - 210
DEDSVYGVFVSYIEIYNNYIYDLLEEVPFDPIKPKPPQSKLLREDKNHNMYVAGCTEVEVKSTEEAFEVF    211 - 280
WRGQKKRRIANTHLNRESSRSHSVFNIKLVQAPLDADGDNVLQEKEQITISQLSLVDLAGSERTNRTRAE    281 - 350
GNRLREAGNINQSLMTLRTCMDVLRENQMYGTNKMVPYRDSKLTHLFKNYFDGEGKVRMIVCVNPKAEDY    351 - 420
EENLQVMRFAEVTQEVEVARPVDKAICGLTPGRRYRNQPRGPVGNEPLVTDVVLQSFPPLPSCEILDIND    421 - 490
EQTLPRLIEALEKRHNLRQMMIDEFNKQSNAFKALLQEFDNAVLSKENHMQGKLNEKEKMISGQKLEIER    491 - 560
LEKKNKTLEYKIEILEKTTTIYEEDKRNLQQELETQNQKLQRQFSDKRRLEARLQGMVTETTMKWEKECE    561 - 630
RRVAAKQLEMQNKLWVKDEKLKQLKAIVTEPKTEKPERPSRERDREKVTQRSVSPSPVPLSSNYIAQISN    631 - 700
GQQLMSQPQLHRRSNSCSSISVASCISEWEQKIPTYNTPLKVTSIARRRQQEPGQSKTCIVSDRRRGMYW    701 - 770
TEGREVVPTFRNEIEIEEDHCGRLLFQPDQNAPPIRLRHRRSRSAGDRWVDHKPASNMQTETVMQPHVPH    771 - 840
AITVSVANEKALAKCEKYMLTHQELASDGEIETKLIKGDIYKTRGGGQSVQFTDIETLKQESPNGSRKRR    841 - 910
SSTVAPAQPDGAESEWTDVETRCSVAVEMRAGSQLGPGYQHHAQPKRKKP                        911 - 960
//

Text Mined References (71)

PMID Year Title