Property Summary

NCBI Gene PubMed Count 54
Grant Count 64
R01 Count 46
Funding $4,467,660.09
PubMed Score 93.77
PubTator Score 80.62

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q02241 B4E1K0 Q8WVP0
Symbols CHO1
KNSL5
MKLP1
MKLP-1

Gene

PDB

3VHX  

Gene RIF (19)

PMID Text
26775597 Data show high level of KIF23 expression in the majority of primary and metastatic lung cancer tissues or cell lines and associates with poor survival.
26674738 In this study we show for the first time that KIF23 V1 and V2 have different localizations in hepatocellular carcinoma cells
25658096 Phosphorylation of S716 NDR/LATS, present only in the longest Kif23 isoform, is required for phosphorylation at S814, revealing phosphorylation at these two sites, and differential regulation of Kif23-14-3-3 interaction for the two Kif23 isoforms.
24128730 TRAF6 mediates ubiquitination of the midbody ring localized protein KIF23/MKLP1.
23650552 Transcriptional regulation of KIF23 is mediated by TP53.
23570799 KIF23 mutation is associated with congenital dyserythropoietic anemia type III.
23562843 v-Src inhibits cytokinesis through the delocalization of Mklp1 and Aurora B from the spindle midzone, resulting in binucleation.
22522702 It was shown that, during cytokinesis, Arf6 is first accumulated around the cleavage furrow and, prior to abscission, recruited onto the Flemming body via interaction with MKLP1.
21904957 The results of this study indicated that downregulation of KIF23 decreases proliferation of glioma cells and that KIF23 may be a novel therapeutic target in malignant glioma.
20508983 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MKSARAKTPRKPTVKKGSQTNLKDPVGVYCRVRPLGFPDQECCIEVINNTTVQLHTPEGYRLNRNGDYKE      1 - 70
TQYSFKQVFGTHTTQKELFDVVANPLVNDLIHGKNGLLFTYGVTGSGKTHTMTGSPGEGGLLPRCLDMIF     71 - 140
NSIGSFQAKRYVFKSNDRNSMDIQCEVDALLERQKREAMPNPKTSSSKRQVDPEFADMITVQEFCKAEEV    141 - 210
DEDSVYGVFVSYIEIYNNYIYDLLEEVPFDPIKPKPPQSKLLREDKNHNMYVAGCTEVEVKSTEEAFEVF    211 - 280
WRGQKKRRIANTHLNRESSRSHSVFNIKLVQAPLDADGDNVLQEKEQITISQLSLVDLAGSERTNRTRAE    281 - 350
GNRLREAGNINQSLMTLRTCMDVLRENQMYGTNKMVPYRDSKLTHLFKNYFDGEGKVRMIVCVNPKAEDY    351 - 420
EENLQVMRFAEVTQEVEVARPVDKAICGLTPGRRYRNQPRGPVGNEPLVTDVVLQSFPPLPSCEILDIND    421 - 490
EQTLPRLIEALEKRHNLRQMMIDEFNKQSNAFKALLQEFDNAVLSKENHMQGKLNEKEKMISGQKLEIER    491 - 560
LEKKNKTLEYKIEILEKTTTIYEEDKRNLQQELETQNQKLQRQFSDKRRLEARLQGMVTETTMKWEKECE    561 - 630
RRVAAKQLEMQNKLWVKDEKLKQLKAIVTEPKTEKPERPSRERDREKVTQRSVSPSPVPLSSNYIAQISN    631 - 700
GQQLMSQPQLHRRSNSCSSISVASCISEWEQKIPTYNTPLKVTSIARRRQQEPGQSKTCIVSDRRRGMYW    701 - 770
TEGREVVPTFRNEIEIEEDHCGRLLFQPDQNAPPIRLRHRRSRSAGDRWVDHKPASNMQTETVMQPHVPH    771 - 840
AITVSVANEKALAKCEKYMLTHQELASDGEIETKLIKGDIYKTRGGGQSVQFTDIETLKQESPNGSRKRR    841 - 910
SSTVAPAQPDGAESEWTDVETRCSVAVEMRAGSQLGPGYQHHAQPKRKKP                        911 - 960
//

Text Mined References (66)

PMID Year Title
26775597 2016 Overexpression of KIF23 predicts clinical outcome in primary lung cancer patients.
26674738 2015 Evaluation of KIF23 variant 1 expression and relevance as a novel prognostic factor in patients with hepatocellular carcinoma.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25658096 2015 Binding of Kif23-iso1/CHO1 to 14-3-3 is regulated by sequential phosphorylations at two LATS kinase consensus sites.
24128730 2013 TRAF6 mediates ubiquitination of KIF23/MKLP1 and is required for midbody ring degradation by selective autophagy.
23650552 2013 p53 and cell cycle dependent transcription of kinesin family member 23 (KIF23) is controlled via a CHR promoter element bound by DREAM and MMB complexes.
23570799 2013 Congenital dyserythropoietic anemia type III (CDA III) is caused by a mutation in kinesin family member, KIF23.
23562843 2013 v-Src causes delocalization of Mklp1, Aurora B, and INCENP from the spindle midzone during cytokinesis failure.
More...