Property Summary

Ligand Count 9
NCBI Gene PubMed Count 66
PubMed Score 140.16
PubTator Score 129.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
MICROCEPHALY 13, PRIMARY, AUTOSOMAL RECESSIVE 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Testicular cancer 25 0.0 2.4
Disease Target Count Z-score Confidence
Microcephaly 166 0.0 4.0

Expression

  Differential Expression (22)

Disease log2 FC p
adrenocortical carcinoma 1.455 9.3e-05
adult high grade glioma 1.500 6.9e-04
Atopic dermatitis 1.400 6.3e-05
atypical teratoid / rhabdoid tumor 2.100 3.2e-08
Breast cancer 2.800 3.0e-02
colon cancer 1.900 1.2e-03
ductal carcinoma in situ 1.700 1.1e-03
Endometriosis 1.229 1.2e-02
glioblastoma 1.900 4.7e-08
group 3 medulloblastoma 2.700 4.7e-05
intraductal papillary-mucinous carcinoma... 1.600 6.8e-05
intraductal papillary-mucinous neoplasm ... 2.300 2.3e-04
invasive ductal carcinoma 2.200 4.7e-05
lung adenocarcinoma 1.100 1.4e-06
lung cancer 2.300 1.9e-04
medulloblastoma, large-cell 2.500 1.3e-05
nasopharyngeal carcinoma 1.100 2.2e-04
non-small cell lung cancer 2.332 8.5e-30
ovarian cancer 2.000 5.4e-12
primary Sjogren syndrome 1.100 5.2e-03
primitive neuroectodermal tumor 2.500 1.6e-05
psoriasis 1.300 1.5e-10

Gene RIF (40)

AA Sequence

MAEEGAVAVCVRVRPLNSREESLGETAQVYWKTDNNVIYQVDGSKSFNFDRVFHGNETTKNVYEEIAAPI      1 - 70
IDSAIQGYNGTIFAYGQTASGKTYTMMGSEDHLGVIPRAIHDIFQKIKKFPDREFLLRVSYMEIYNETIT     71 - 140
DLLCGTQKMKPLIIREDVNRNVYVADLTEEVVYTSEMALKWITKGEKSRHYGETKMNQRSSRSHTIFRMI    141 - 210
LESREKGEPSNCEGSVKVSHLNLVDLAGSERAAQTGAAGVRLKEGCNINRSLFILGQVIKKLSDGQVGGF    211 - 280
INYRDSKLTRILQNSLGGNAKTRIICTITPVSFDETLTALQFASTAKYMKNTPYVNEVSTDEALLKRYRK    281 - 350
EIMDLKKQLEEVSLETRAQAMEKDQLAQLLEEKDLLQKVQNEKIENLTRMLVTSSSLTLQQELKAKRKRR    351 - 420
VTWCLGKINKMKNSNYADQFNIPTNITTKTHKLSINLLREIDESVCSESDVFSNTLDTLSEIEWNPATKL    421 - 490
LNQENIESELNSLRADYDNLVLDYEQLRTEKEEMELKLKEKNDLDEFEALERKTKKDQEMQLIHEISNLK    491 - 560
NLVKHAEVYNQDLENELSSKVELLREKEDQIKKLQEYIDSQKLENIKMDLSYSLESIEDPKQMKQTLFDA    561 - 630
ETVALDAKRESAFLRSENLELKEKMKELATTYKQMENDIQLYQSQLEAKKKMQVDLEKELQSAFNEITKL    631 - 700
TSLIDGKVPKDLLCNLELEGKITDLQKELNKEVEENEALREEVILLSELKSLPSEVERLRKEIQDKSEEL    701 - 770
HIITSEKDKLFSEVVHKESRVQGLLEEIGKTKDDLATTQSNYKSTDQEFQNFKTLHMDFEQKYKMVLEEN    771 - 840
ERMNQEIVNLSKEAQKFDSSLGALKTELSYKTQELQEKTREVQERLNEMEQLKEQLENRDSTLQTVEREK    841 - 910
TLITEKLQQTLEEVKTLTQEKDDLKQLQESLQIERDQLKSDIHDTVNMNIDTQEQLRNALESLKQHQETI    911 - 980
NTLKSKISEEVSRNLHMEENTGETKDEFQQKMVGIDKKQDLEAKNTQTLTADVKDNEIIEQQRKIFSLIQ    981 - 1050
EKNELQQMLESVIAEKEQLKTDLKENIEMTIENQEELRLLGDELKKQQEIVAQEKNHAIKKEGELSRTCD   1051 - 1120
RLAEVEEKLKEKSQQLQEKQQQLLNVQEEMSEMQKKINEIENLKNELKNKELTLEHMETERLELAQKLNE   1121 - 1190
NYEEVKSITKERKVLKELQKSFETERDHLRGYIREIEATGLQTKEELKIAHIHLKEHQETIDELRRSVSE   1191 - 1260
KTAQIINTQDLEKSHTKLQEEIPVLHEEQELLPNVKEVSETQETMNELELLTEQSTTKDSTTLARIEMER   1261 - 1330
LRLNEKFQESQEEIKSLTKERDNLKTIKEALEVKHDQLKEHIRETLAKIQESQSKQEQSLNMKEKDNETT   1331 - 1400
KIVSEMEQFKPKDSALLRIEIEMLGLSKRLQESHDEMKSVAKEKDDLQRLQEVLQSESDQLKENIKEIVA   1401 - 1470
KHLETEEELKVAHCCLKEQEETINELRVNLSEKETEISTIQKQLEAINDKLQNKIQEIYEKEEQFNIKQI   1471 - 1540
SEVQEKVNELKQFKEHRKAKDSALQSIESKMLELTNRLQESQEEIQIMIKEKEEMKRVQEALQIERDQLK   1541 - 1610
ENTKEIVAKMKESQEKEYQFLKMTAVNETQEKMCEIEHLKEQFETQKLNLENIETENIRLTQILHENLEE   1611 - 1680
MRSVTKERDDLRSVEETLKVERDQLKENLRETITRDLEKQEELKIVHMHLKEHQETIDKLRGIVSEKTNE   1681 - 1750
ISNMQKDLEHSNDALKAQDLKIQEELRIAHMHLKEQQETIDKLRGIVSEKTDKLSNMQKDLENSNAKLQE   1751 - 1820
KIQELKANEHQLITLKKDVNETQKKVSEMEQLKKQIKDQSLTLSKLEIENLNLAQKLHENLEEMKSVMKE   1821 - 1890
RDNLRRVEETLKLERDQLKESLQETKARDLEIQQELKTARMLSKEHKETVDKLREKISEKTIQISDIQKD   1891 - 1960
LDKSKDELQKKIQELQKKELQLLRVKEDVNMSHKKINEMEQLKKQFEAQNLSMQSVRMDNFQLTKKLHES   1961 - 2030
LEEIRIVAKERDELRRIKESLKMERDQFIATLREMIARDRQNHQVKPEKRLLSDGQQHLTESLREKCSRI   2031 - 2100
KELLKRYSEMDDHYECLNRLSLDLEKEIEFQKELSMRVKANLSLPYLQTKHIEKLFTANQRCSMEFHRIM   2101 - 2170
KKLKYVLSYVTKIKEEQHESINKFEMDFIDEVEKQKELLIKIQHLQQDCDVPSRELRDLKLNQNMDLHIE   2171 - 2240
EILKDFSESEFPSIKTEFQQVLSNRKEMTQFLEEWLNTRFDIEKLKNGIQKENDRICQVNNFFNNRIIAI   2241 - 2310
MNESTEFEERSATISKEWEQDLKSLKEKNEKLFKNYQTLKTSLASGAQVNPTTQDNKNPHVTSRATQLTT   2311 - 2380
EKIRELENSLHEAKESAMHKESKIIKMQKELEVTNDIIAKLQAKVHESNKCLEKTKETIQVLQDKVALGA   2381 - 2450
KPYKEEIEDLKMKLVKIDLEKMKNAKEFEKEISATKATVEYQKEVIRLLRENLRRSQQAQDTSVISEHTD   2451 - 2520
PQPSNKPLTCGGGSGIVQNTKALILKSEHIRLEKEISKLKQQNEQLIKQKNELLSNNQHLSNEVKTWKER   2521 - 2590
TLKREAHKQVTCENSPKSPKVTGTASKKKQITPSQCKERNLQDPVPKESPKSCFFDSRSKSLPSPHPVRY   2591 - 2660
FDNSSLGLCPEVQNAGAESVDSQPGPWHASSGKDVPECKTQ                                2661 - 2701
//

Text Mined References (71)

PMID Year Title