Property Summary

NCBI Gene PubMed Count 63
PubMed Score 135.79
PubTator Score 129.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
psoriasis 6685 2.22914113112699E-58
non-small cell lung cancer 2798 8.51486227415999E-30
ovarian cancer 8492 5.39178166926179E-12
lung adenocarcinoma 2714 2.23299849966108E-8
atypical teratoid / rhabdoid tumor 4369 3.18233422938778E-8
lung cancer 4473 2.34078257515833E-7
medulloblastoma, large-cell 6234 1.2838313672631E-5
primitive neuroectodermal tumor 3031 1.58561069047075E-5
pediatric high grade glioma 2712 1.83541523801845E-5
glioblastoma 5572 1.87229274332777E-5
group 3 medulloblastoma 2254 4.67096056649816E-5
invasive ductal carcinoma 2950 4.67211959815989E-5
Atopic dermatitis 944 6.33560374698999E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 6.75554956652558E-5
adrenocortical carcinoma 1427 9.29795791098348E-5
nasopharyngeal carcinoma 1056 2.17791876214571E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 2.28815117516323E-4
ductal carcinoma in situ 1745 0.00113297196100068
colon cancer 1475 0.00118721738520193
primary Sjogren syndrome 789 0.00522789772329528
Endometriosis 535 0.0117833080860413
Breast cancer 3099 0.0301388007076906
Disease Target Count Z-score Confidence
Testicular cancer 24 0.0 2.0
Disease Target Count Z-score Confidence
Microcephaly 149 0.0 4.0
Disease Target Count Z-score Confidence
Cancer 2346 3.21 1.6

Expression

Synonym

Accession Q02224 A6NKY9 A8K2U7 Q4LE75
Symbols KIF10
CENP-E
MCPH13
PPP1R61

Gene

PDB

1T5C   5JVP  

  Ortholog (10)

Gene RIF (37)

PMID Text
26321640 CTCF helps recruit CENP-E to the centromere during mitosis and that it may do so through a structure stabilized by the CTCF/CENP-E complex.
25908662 CENP-E-driven chromosome congression is guided by microtubule detyrosination.
25743205 Chromokinesin Kid and kinetochore kinesin CENP-E differentially support chromosome congression without end-on attachment to microtubules.
25395579 CENP-Q - a subunit of the CENP-O complex (comprising CENP-O, CENP-P, CENP-Q and CENP-U) that targets polo-like kinase (Plk1) to kinetochores - is also required for the recruitment of CENP-E to kinetochores.
25383660 dynein and CENP-E at kinetochores drive congression of peripheral polar chromosomes by preventing arm-ejection forces mediated by chromokinesins from working in the wrong direction.
24928852 CENP-E expression is highest in basal-like subtype among breast cancer patients.
24920822 An unexpected role of CENP-E elongated stalk in ensuring stability of kinetochore-microtubule attachments during chromosome congression and segregation.
24748105 Mutations in CENPE define a novel kinetochore-centromeric mechanism for microcephalic primordial dwarfism.
23955301 Kinetochore kinesin CENP-E is a processive bi-directional tracker of dynamic microtubule tips.
23891108 A CENP-E mediated wall-tethering event and a MCAK-mediated wall-removing event show that human chromosome-microtubule attachment is achieved through a set of deterministic sequential events rather than stochastic direct capture of microtubule ends.
More...

AA Sequence

MAEEGAVAVCVRVRPLNSREESLGETAQVYWKTDNNVIYQVDGSKSFNFDRVFHGNETTKNVYEEIAAPI      1 - 70
IDSAIQGYNGTIFAYGQTASGKTYTMMGSEDHLGVIPRAIHDIFQKIKKFPDREFLLRVSYMEIYNETIT     71 - 140
DLLCGTQKMKPLIIREDVNRNVYVADLTEEVVYTSEMALKWITKGEKSRHYGETKMNQRSSRSHTIFRMI    141 - 210
LESREKGEPSNCEGSVKVSHLNLVDLAGSERAAQTGAAGVRLKEGCNINRSLFILGQVIKKLSDGQVGGF    211 - 280
INYRDSKLTRILQNSLGGNAKTRIICTITPVSFDETLTALQFASTAKYMKNTPYVNEVSTDEALLKRYRK    281 - 350
EIMDLKKQLEEVSLETRAQAMEKDQLAQLLEEKDLLQKVQNEKIENLTRMLVTSSSLTLQQELKAKRKRR    351 - 420
VTWCLGKINKMKNSNYADQFNIPTNITTKTHKLSINLLREIDESVCSESDVFSNTLDTLSEIEWNPATKL    421 - 490
LNQENIESELNSLRADYDNLVLDYEQLRTEKEEMELKLKEKNDLDEFEALERKTKKDQEMQLIHEISNLK    491 - 560
NLVKHAEVYNQDLENELSSKVELLREKEDQIKKLQEYIDSQKLENIKMDLSYSLESIEDPKQMKQTLFDA    561 - 630
ETVALDAKRESAFLRSENLELKEKMKELATTYKQMENDIQLYQSQLEAKKKMQVDLEKELQSAFNEITKL    631 - 700
TSLIDGKVPKDLLCNLELEGKITDLQKELNKEVEENEALREEVILLSELKSLPSEVERLRKEIQDKSEEL    701 - 770
HIITSEKDKLFSEVVHKESRVQGLLEEIGKTKDDLATTQSNYKSTDQEFQNFKTLHMDFEQKYKMVLEEN    771 - 840
ERMNQEIVNLSKEAQKFDSSLGALKTELSYKTQELQEKTREVQERLNEMEQLKEQLENRDSTLQTVEREK    841 - 910
TLITEKLQQTLEEVKTLTQEKDDLKQLQESLQIERDQLKSDIHDTVNMNIDTQEQLRNALESLKQHQETI    911 - 980
NTLKSKISEEVSRNLHMEENTGETKDEFQQKMVGIDKKQDLEAKNTQTLTADVKDNEIIEQQRKIFSLIQ    981 - 1050
EKNELQQMLESVIAEKEQLKTDLKENIEMTIENQEELRLLGDELKKQQEIVAQEKNHAIKKEGELSRTCD   1051 - 1120
RLAEVEEKLKEKSQQLQEKQQQLLNVQEEMSEMQKKINEIENLKNELKNKELTLEHMETERLELAQKLNE   1121 - 1190
NYEEVKSITKERKVLKELQKSFETERDHLRGYIREIEATGLQTKEELKIAHIHLKEHQETIDELRRSVSE   1191 - 1260
KTAQIINTQDLEKSHTKLQEEIPVLHEEQELLPNVKEVSETQETMNELELLTEQSTTKDSTTLARIEMER   1261 - 1330
LRLNEKFQESQEEIKSLTKERDNLKTIKEALEVKHDQLKEHIRETLAKIQESQSKQEQSLNMKEKDNETT   1331 - 1400
KIVSEMEQFKPKDSALLRIEIEMLGLSKRLQESHDEMKSVAKEKDDLQRLQEVLQSESDQLKENIKEIVA   1401 - 1470
KHLETEEELKVAHCCLKEQEETINELRVNLSEKETEISTIQKQLEAINDKLQNKIQEIYEKEEQFNIKQI   1471 - 1540
SEVQEKVNELKQFKEHRKAKDSALQSIESKMLELTNRLQESQEEIQIMIKEKEEMKRVQEALQIERDQLK   1541 - 1610
ENTKEIVAKMKESQEKEYQFLKMTAVNETQEKMCEIEHLKEQFETQKLNLENIETENIRLTQILHENLEE   1611 - 1680
MRSVTKERDDLRSVEETLKVERDQLKENLRETITRDLEKQEELKIVHMHLKEHQETIDKLRGIVSEKTNE   1681 - 1750
ISNMQKDLEHSNDALKAQDLKIQEELRIAHMHLKEQQETIDKLRGIVSEKTDKLSNMQKDLENSNAKLQE   1751 - 1820
KIQELKANEHQLITLKKDVNETQKKVSEMEQLKKQIKDQSLTLSKLEIENLNLAQKLHENLEEMKSVMKE   1821 - 1890
RDNLRRVEETLKLERDQLKESLQETKARDLEIQQELKTARMLSKEHKETVDKLREKISEKTIQISDIQKD   1891 - 1960
LDKSKDELQKKIQELQKKELQLLRVKEDVNMSHKKINEMEQLKKQFEAQNLSMQSVRMDNFQLTKKLHES   1961 - 2030
LEEIRIVAKERDELRRIKESLKMERDQFIATLREMIARDRQNHQVKPEKRLLSDGQQHLTESLREKCSRI   2031 - 2100
KELLKRYSEMDDHYECLNRLSLDLEKEIEFQKELSMRVKANLSLPYLQTKHIEKLFTANQRCSMEFHRIM   2101 - 2170
KKLKYVLSYVTKIKEEQHESINKFEMDFIDEVEKQKELLIKIQHLQQDCDVPSRELRDLKLNQNMDLHIE   2171 - 2240
EILKDFSESEFPSIKTEFQQVLSNRKEMTQFLEEWLNTRFDIEKLKNGIQKENDRICQVNNFFNNRIIAI   2241 - 2310
MNESTEFEERSATISKEWEQDLKSLKEKNEKLFKNYQTLKTSLASGAQVNPTTQDNKNPHVTSRATQLTT   2311 - 2380
EKIRELENSLHEAKESAMHKESKIIKMQKELEVTNDIIAKLQAKVHESNKCLEKTKETIQVLQDKVALGA   2381 - 2450
KPYKEEIEDLKMKLVKIDLEKMKNAKEFEKEISATKATVEYQKEVIRLLRENLRRSQQAQDTSVISEHTD   2451 - 2520
PQPSNKPLTCGGGSGIVQNTKALILKSEHIRLEKEISKLKQQNEQLIKQKNELLSNNQHLSNEVKTWKER   2521 - 2590
TLKREAHKQVTCENSPKSPKVTGTASKKKQITPSQCKERNLQDPVPKESPKSCFFDSRSKSLPSPHPVRY   2591 - 2660
FDNSSLGLCPEVQNAGAESVDSQPGPWHASSGKDVPECKTQ                                2661 - 2701
//

Text Mined References (68)

PMID Year Title
26321640 2015 CTCF Recruits Centromeric Protein CENP-E to the Pericentromeric/Centromeric Regions of Chromosomes through Unusual CTCF-Binding Sites.
25918224 2015 TRAMM/TrappC12 plays a role in chromosome congression, kinetochore stability, and CENP-E recruitment.
25908662 2015 Mitosis. Microtubule detyrosination guides chromosomes during mitosis.
25743205 2015 Chromokinesin Kid and kinetochore kinesin CENP-E differentially support chromosome congression without end-on attachment to microtubules.
25395579 2015 Chromosome congression is promoted by CENP-Q- and CENP-E-dependent pathways.
25383660 2014 Kinetochore motors drive congression of peripheral polar chromosomes by overcoming random arm-ejection forces.
24928852 2014 Chemogenetic evaluation of the mitotic kinesin CENP-E reveals a critical role in triple-negative breast cancer.
24920822 2014 Kinetochore-microtubule attachment throughout mitosis potentiated by the elongated stalk of the kinetochore kinesin CENP-E.
24748105 2014 Mutations in CENPE define a novel kinetochore-centromeric mechanism for microcephalic primordial dwarfism.
23955301 2013 Kinetochore kinesin CENP-E is a processive bi-directional tracker of dynamic microtubule tips.
More...