Property Summary

NCBI Gene PubMed Count 50
PubMed Score 537.83
PubTator Score 107.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
colon cancer -3.000 1.9e-07
cutaneous lupus erythematosus 3.400 6.3e-03
cystic fibrosis and chronic rhinosinusit... 1.077 3.4e-02
gastric cancer 2.300 9.8e-04
hepatocellular carcinoma 1.600 6.4e-03
interstitial cystitis 3.900 2.2e-02
lung cancer -2.900 2.3e-06
mucosa-associated lymphoid tissue lympho... 1.035 4.8e-02
osteosarcoma -6.143 7.3e-17
pancreatic cancer 3.200 4.3e-03
pancreatic carcinoma 3.200 4.3e-03
periodontitis 2.400 2.1e-27
primary Sjogren syndrome 1.600 2.8e-04
tuberculosis 2.000 6.1e-03
ulcerative colitis 3.200 1.3e-05

Protein-protein Interaction (10)

Gene RIF (39)

AA Sequence

MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAILWTCLGLSLIISLAV      1 - 70
FVLMFLLRKINSEPLKDEFKNTGSGLLGMANIDLEKSRTGDEIILPRGLEYTVEECTCEDCIKSKPKVDS     71 - 140
DHCFPLPAMEEGATILVTTKTNDYCKSLPAALSATEIEKSISAR                              141 - 184
//

Text Mined References (52)

PMID Year Title