Property Summary

NCBI Gene PubMed Count 44
Grant Count 863
R01 Count 104
Funding $760,208,516.48
PubMed Score 506.87
PubTator Score 107.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
gastric cancer 2.300 0.001
hepatocellular carcinoma 1.600 0.006
pancreatic cancer 3.200 0.004
cutaneous lupus erythematosus 3.400 0.006
osteosarcoma -6.143 0.000
periodontitis 2.400 0.000
tuberculosis 2.000 0.006
colon cancer -3.000 0.000
lung cancer -2.900 0.000
interstitial cystitis 4.000 0.004
primary Sjogren syndrome 1.600 0.000
pancreatic carcinoma 3.200 0.004
mucosa-associated lymphoid tissue lympho... 1.035 0.048
ulcerative colitis 3.200 0.000
cystic fibrosis and chronic rhinosinusit... 1.077 0.034

Synonym

Accession Q02223 Q2TQ40
Symbols BCM
BCMA
CD269
TNFRSF13A

Gene

PDB

1OQD   1XU2   2KN1   4ZFO  

Gene RIF (33)

PMID Text
26914861 results suggest that Akt and JNK pathways are involved in the regulation of B-cell maturation antigen (BCMA)
26065893 shedding of BCMA by gamma-secretase controls plasma cells in the bone marrow and yields a potential biomarker for B-cell involvement in human autoimmune diseases
25759827 elevated serum levels in patients with Behcet's disease
25750171 High BCMA expression is associated with breast cancer.
25301447 Data show significant differences in expression of tumour necrosis factor family (BAFF) receptors BAFF-R, BCMA and TACI in patients with and without anti-Jo-1 or anti-Ro52/anti-Ro60 autoantibodies.
24376672 BAFF and APRIL as well as their cognate receptors (BCMA, TACI) correlate with glioma grade. (Meta-analysis)
23776238 B-cell maturation antigen (BCMA), an essential membrane protein for maintaining the survival of plasma cells, was identified as a glycoprotein exhibiting complex-type N-glycans at a single N-glycosylation site, asparagine 42.
23728352 Data indicate that MAGE3, Survivin and B-cell maturation antigen (BCMA) mRNA-pulsed dendritic cells (DCs) are capable of stimulating tumor-associated antigens (TAA)-specific T-cell responses in multiple myeloma (MM) patients.
23344265 Data indicate that B-cell maturation antigen (BCMA) is a suitable target for chimeric antigen receptor (CAR)-expressing T cells, and adoptive transfer of anti-BCMA-CAR-expressing T cells is a promising new strategy for treating multiple myeloma.
23237506 The B cell maturation antigen (BCMA) is a tumor necrosis family receptor member that is predominantly expressed on terminally differentiated B cells and, upon binding to its ligands B cell activator of the TNF family and a proliferation inducing ligand.
More...

AA Sequence

MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAILWTCLGLSLIISLAV      1 - 70
FVLMFLLRKINSEPLKDEFKNTGSGLLGMANIDLEKSRTGDEIILPRGLEYTVEECTCEDCIKSKPKVDS     71 - 140
DHCFPLPAMEEGATILVTTKTNDYCKSLPAALSATEIEKSISAR                              141 - 184
//

Text Mined References (46)

PMID Year Title
26914861 2016 Binding of B-cell maturation antigen to B-cell activating factor induces survival of multiple myeloma cells by activating Akt and JNK signaling pathways.
26065893 2015 ?-Secretase directly sheds the survival receptor BCMA from plasma cells.
25759827 2014 Expression of TNF-?, APRIL and BCMA in Behcet's disease.
25750171 2015 APRIL promotes breast tumor growth and metastasis and is associated with aggressive basal breast cancer.
25301447 2014 Expression of BAFF receptors in muscle tissue of myositis patients with anti-Jo-1 or anti-Ro52/anti-Ro60 autoantibodies.
24376672 2013 BAFF, APRIL, TWEAK, BCMA, TACI and Fn14 proteins are related to human glioma tumor grade: immunohistochemistry and public microarray data meta-analysis.
23776238 2013 B-cell maturation antigen is modified by a single N-glycan chain that modulates ligand binding and surface retention.
23728352 2013 Immunogenicity of dendritic cells pulsed with MAGE3, Survivin and B-cell maturation antigen mRNA for vaccination of multiple myeloma patients.
23344265 2013 B-cell maturation antigen is a promising target for adoptive T-cell therapy of multiple myeloma.
23237506 2012 Regulatory roles of the tumor necrosis factor receptor BCMA.
More...