Property Summary

NCBI Gene PubMed Count 19
Grant Count 97
R01 Count 51
Funding $9,366,959.15
PubMed Score 271.21
PubTator Score 51.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
astrocytic glioma 1.400 0.003
ependymoma 2.200 0.013
oligodendroglioma 2.100 0.001
psoriasis -1.200 0.001
glioblastoma 1.500 0.010
medulloblastoma 1.300 0.016
medulloblastoma, large-cell 1.500 0.000
ovarian cancer -1.100 0.000
dermatomyositis -2.300 0.000

Synonym

Accession Q02218 B4E2U9 D3DVL0 E9PBM1 Q96DD3 Q9UDX0
Symbols E1k
OGDC
AKGDH

Gene

PDB

3ERY  

Gene RIF (8)

PMID Text
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of oxoglutarate (alpha-ketoglutarate) dehydrogenase (OGDH) expression by HIV-1 Vpr in Vpr transduced macrophages
23475850 ATP consumption is demonstrated in respiration-impaired isolated mice and in situ neuronal mitochondria from transgenic mice with dihydrolipoyl succinyltransferase deficiency.
22169199 Acute inhibition of alpha-ketoglutarate dehydrogenase produces effects on calcium opposite to those in Alzheimer's disease (AD), while the chronic or long-term inhibition of alpha-KGDHC mimicked the AD-related changes in calcium.
21611730 Differences in oxoglutarate dehydrogenase activity suggest that there is no excess mitochondrial capacity during maximal exercise with a small muscle mass.
20877624 Observational study of gene-disease association. (HuGE Navigator)
17343268 Association with autosomal recessive DOOR syndrome not found.
15649899 Reduction in the E2k subunit of the alpha-ketoglutarate dehydrogenase complex has effects independent of complex activity.
15466852 2-oxoglutarate (alpha-ketoglutarate) dehydrogenase stability is regulated by the RING finger ubiquitin ligase Siah

AA Sequence

MFHLRTCAAKLRPLTASQTVKTFSQNRPAAARTFQQIRCYSAPVAAEPFLSGTSSNYVEEMYCAWLENPK      1 - 70
SVHKSWDIFFRNTNAGAPPGTAYQSPLPLSRGSLAAVAHAQSLVEAQPNVDKLVEDHLAVQSLIRAYQIR     71 - 140
GHHVAQLDPLGILDADLDSSVPADIISSTDKLGFYGLDESDLDKVFHLPTTTFIGGQESALPLREIIRRL    141 - 210
EMAYCQHIGVEFMFINDLEQCQWIRQKFETPGIMQFTNEEKRTLLARLVRSTRFEEFLQRKWSSEKRFGL    211 - 280
EGCEVLIPALKTIIDKSSENGVDYVIMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEAADEGSGDVKYH    281 - 350
LGMYHRRINRVTDRNITLSLVANPSHLEAADPVVMGKTKAEQFYCGDTEGKKVMSILLHGDAAFAGQGIV    351 - 420
YETFHLSDLPSYTTHGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNSDDPEAVMYVCKVA    421 - 490
AEWRSTFHKDVVVDLVCYRRNGHNEMDEPMFTQPLMYKQIRKQKPVLQKYAELLVSQGVVNQPEYEEEIS    491 - 560
KYDKICEEAFARSKDEKILHIKHWLDSPWPGFFTLDGQPRSMSCPSTGLTEDILTHIGNVASSVPVENFT    561 - 630
IHGGLSRILKTRGEMVKNRTVDWALAEYMAFGSLLKEGIHIRLSGQDVERGTFSHRHHVLHDQNVDKRTC    631 - 700
IPMNHLWPNQAPYTVCNSSLSEYGVLGFELGFAMASPNALVLWEAQFGDFHNTAQCIIDQFICPGQAKWV    701 - 770
RQNGIVLLLPHGMEGMGPEHSSARPERFLQMCNDDPDVLPDLKEANFDINQLYDCNWVVVNCSTPGNFFH    771 - 840
VLRRQILLPFRKPLIIFTPKSLLRHPEARSSFDEMLPGTHFQRVIPEDGPAAQNPENVKRLLFCTGKVYY    841 - 910
DLTRERKARDMVGQVAITRIEQLSPFPFDLLLKEVQKYPNAELAWCQEEHKNQGYYDYVKPRLRTTISRA    911 - 980
KPVWYAGRDPAAAPATGNKKTHLTELQRLLDTAFDLDVFKNFS                               981 - 1023
//

Text Mined References (29)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24495017 2014 Studies on the regulation of the human E1 subunit of the 2-oxoglutarate dehydrogenase complex, including the identification of a novel calcium-binding site.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23475850 2013 The negative impact of ?-ketoglutarate dehydrogenase complex deficiency on matrix substrate-level phosphorylation.
22169199 2012 Deficits in the mitochondrial enzyme ?-ketoglutarate dehydrogenase lead to Alzheimer's disease-like calcium dysregulation.
21611730 2011 Exercise training induces similar elevations in the activity of oxoglutarate dehydrogenase and peak oxygen uptake in the human quadriceps muscle.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18973345 2008 Different thermodynamic binding mechanisms and peptide fine specificities associated with a panel of structurally similar high-affinity T cell receptors.
More...