Property Summary

NCBI Gene PubMed Count 147
PubMed Score 685.77
PubTator Score 1215.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.100 4.2e-05
mucosa-associated lymphoid tissue lympho... 2.460 1.3e-02
osteosarcoma -6.774 2.0e-14
psoriasis -2.600 1.2e-05

Synonym

Accession Q02161 Q02162 Q07618 Q16147 Q16235 Q16355 Q5VSK0 Q5XLS9 Q5XLT1 Q5XLT2 Q9NPK0 Q9UQ20 Q9UQ21 Q9UQ22 Q9UQ23
Symbols RH
Rh4
RH30
RhII
RhPI
DIIIc
RHCED
RHDel
RHPII
RhDCw
CD240D
RHXIII
RHDVA(TT)
RhK562-II

Gene

RHD

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

Gene RIF (107)

AA Sequence

MSSKYPRSVRRCLPLWALTLEAALILLFYFFTHYDASLEDQKGLVASYQVGQDLTVMAAIGLGFLTSSFR      1 - 70
RHSWSSVAFNLFMLALGVQWAILLDGFLSQFPSGKVVITLFSIRLATMSALSVLISVDAVLGKVNLAQLV     71 - 140
VMVLVEVTALGNLRMVISNIFNTDYHMNMMHIYVFAAYFGLSVAWCLPKPLPEGTEDKDQTATIPSLSAM    141 - 210
LGALFLWMFWPSFNSALLRSPIERKNAVFNTYYAVAVSVVTAISGSSLAHPQGKISKTYVHSAVLAGGVA    211 - 280
VGTSCHLIPSPWLAMVLGLVAGLISVGGAKYLPGCCNRVLGIPHSSIMGYNFSLLGLLGEIIYIVLLVLD    281 - 350
TVGAGNGMIGFQVLLSIGELSLAIVIALMSGLLTGLLLNLKIWKAPHEAKYFDDQVFWKFPHLAVGF       351 - 417
//

Text Mined References (149)

PMID Year Title