Property Summary

NCBI Gene PubMed Count 141
Grant Count 74
R01 Count 46
Funding $8,647,663.18
PubMed Score 648.15
PubTator Score 1215.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
psoriasis -2.600 0.000
osteosarcoma -6.774 0.000
mucosa-associated lymphoid tissue lympho... 2.460 0.013

Synonym

Accession Q02161 Q02162 Q07618 Q16147 Q16235 Q16355 Q5VSK0 Q5XLS9 Q5XLT1 Q5XLT2 Q9NPK0 Q9UQ20 Q9UQ21 Q9UQ22 Q9UQ23
Symbols RH
Rh4
RH30
RhII
RhPI
DIIIc
RHCED
RHDel
RHPII
RhDCw
CD240D
RHXIII
RHDVA(TT)
RhK562-II

Gene

RHD

PANTHER Protein Class (2)

Gene RIF (102)

PMID Text
26579938 The RHCE gene intron 4 of Han Chinese, Tibetans, and Mongols differs from the RHD gene intron 4 in the presence of a 652-bp fragment.
26482434 Occurrence of partial RhD alleles in the Tunisian population.
26340140 Reduced expression of D antigen is caused not only by missense mutation of the RHD gene, but also by silent mutation that may affect splicing.
26033335 The data indicate that partial DEL women appear at risk of alloimmunization to the D antigen.
25857637 An uneven distribution of RH variant alleles between Dogon and Fulani, in Mali. A high incidence of predicted partial-C phenotype encoded by RHCE*Ce-D(4)-ce was found in Fulani.
25808592 Splicing is altered in RHD*weak D Type 2 allele, a rare variant most commonly found in Caucasians; RHD including the full-length Exon 9 is transcribed in the presence of the c.1227G>A substitution frequently carried by Asians with DEL phenotype.
25495174 Loss of heterozygosity of RhD gene on chromosome 1p in acute myeloid leukemia.
25413499 Despite the enormous diversity of RHD alleles, first-line weak D genotyping was remarkably informative, allowing for rapid classification of most samples with conspicuous RhD phenotype in Flanders, Belgium.
25369614 Weak D type 4.0 appears to be the most prevalent weak D in our population. However, all samples must be sequenced in order to determine the exact subtype of weak D type 4, since weak D type 4.2 has considerable clinical importance
25219636 Serologic findings of RhD alleles in Egyptians and their clinical implications.
More...

AA Sequence

MSSKYPRSVRRCLPLWALTLEAALILLFYFFTHYDASLEDQKGLVASYQVGQDLTVMAAIGLGFLTSSFR      1 - 70
RHSWSSVAFNLFMLALGVQWAILLDGFLSQFPSGKVVITLFSIRLATMSALSVLISVDAVLGKVNLAQLV     71 - 140
VMVLVEVTALGNLRMVISNIFNTDYHMNMMHIYVFAAYFGLSVAWCLPKPLPEGTEDKDQTATIPSLSAM    141 - 210
LGALFLWMFWPSFNSALLRSPIERKNAVFNTYYAVAVSVVTAISGSSLAHPQGKISKTYVHSAVLAGGVA    211 - 280
VGTSCHLIPSPWLAMVLGLVAGLISVGGAKYLPGCCNRVLGIPHSSIMGYNFSLLGLLGEIIYIVLLVLD    281 - 350
TVGAGNGMIGFQVLLSIGELSLAIVIALMSGLLTGLLLNLKIWKAPHEAKYFDDQVFWKFPHLAVGF       351 - 417
//

Text Mined References (143)

PMID Year Title
26579938 2016 Intron 4 of the RH Gene in Han Chinese, Tibetan, and Mongol Populations.
26482434 2015 Occurrence of partial RhD alleles in the Tunisian population.
26340140 2016 Weak D alleles in Japanese: a c.960G>A silent mutation in exon 7 of the RHD gene that affects D expression.
26033335 2015 Anti-D alloimmunisation in pregnant women with DEL phenotype in China.
25857637 2015 RH diversity in Mali: characterization of a new haplotype RHD*DIVa/RHCE*ceTI(D2).
25808592 2015 Extensive functional analyses of RHD splice site variants: Insights into the potential role of splicing in the physiology of Rh.
25495174 2015 Mixed fields on RhD typing as an indication of loss of heterozygosity on chromosome 1p in acute myeloid leukemia.
25413499 2015 RHD variants in Flanders, Belgium.
25369614 2015 Weak D in the Tunisian population.
25219636 2014 Serologic findings of RhD alleles in Egyptians and their clinical implications.
More...