Property Summary

NCBI Gene PubMed Count 268
PubMed Score 21.92
PubTator Score 387.91

Knowledge Summary

Patent (5,673)


  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -2.500 0.001
ependymoma -3.000 0.002
oligodendroglioma -2.200 0.004
glioblastoma -3.000 0.000
osteosarcoma 1.689 0.000
medulloblastoma -3.800 0.000
atypical teratoid / rhabdoid tumor -3.200 0.000
medulloblastoma, large-cell -3.500 0.000
primitive neuroectodermal tumor -2.400 0.001
non-small cell lung cancer -2.149 0.000
adult high grade glioma -2.800 0.000
pilocytic astrocytoma -2.500 0.000
lung adenocarcinoma -1.400 0.000


Accession Q02156 B0LPH7 Q32MQ3 Q53SL4 Q53SM5 Q9UE81
Symbols PKCE




  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases

Gene RIF (217)

26821209 Docosahexaenoic acid increase the efficacy of docetaxel in mammary cancer cells by downregulating Akt and PKCepsilon/delta-induced ERK pathways.
26075907 HIV-1 Nef involves PRKCE in the induction of IL6 and CXCL8 (IL8) expression
26023164 PKCepsilon is a key factor for driving the formation of bone metastasis by prostate cancer cells and is a potential therapeutic target for advanced stages of the disease.
25883219 PKCepsilon-CREB-Nrf2 signalling induces HO-1 in the vascular endothelium and enhances resistance to inflammation and apoptosis.
25788289 miR-34a regulates blood-tumor barrier (BTB) function by targeting PKCepsilon; after phosphorylation, PKCepsilon is activated and contributes to regulation of the expression of tight junction-related proteins, ultimately altering BTB permeability.
25778903 Depletion of PKCepsilon not only enhanced HGF-induced phosphorylation of JNK and paxillin (Ser178) but also prevented c-Met degradation.
25483024 PKCepsilon-mediated regulation has a role in protection from loss of chromosome integrity in cells failing to resolve catenation in G2
25372487 PKC-delta activates p38/MAPK, responsible for the inhibition of MMP-2 and -9 secretion, PKC-epsilon activates a pathway made of ERK1/2, mTOR and S6K responsible for the inhibition of NHE1 activity and cell migration.
25322815 Suggest distinct role of PKCepsilon in controlling cell fate and immune response of monocyte subsets.
25308712 MicroRNA-146a controls Th1-cell differentiation of human CD4-positive T-lymphocytes by targeting PKCepsilon.

AA Sequence

DFTREEPVLTLVDEAIVKQINQEEFKGFSYFGEDLMP                                     701 - 737

Text Mined References (283)

PMID Year Title
26821209 2016 Long chain n-3 polyunsaturated fatty acids increase the efficacy of docetaxel in mammary cancer cells by downregulating Akt and PKC?/?-induced ERK pathways.
26023164 2015 PKC? Is an Essential Mediator of Prostate Cancer Bone Metastasis.
25883219 2015 PKC?-CREB-Nrf2 signalling induces HO-1 in the vascular endothelium and enhances resistance to inflammation and apoptosis.
25788289 2015 MiR-34a regulates blood-tumor barrier function by targeting protein kinase C?.
25778903 2015 PKC?-mediated c-Met endosomal processing directs fluctuant c-Met-JNK-paxillin signaling for tumor progression of HepG2.
25483024 2014 Mitotic catenation is monitored and resolved by a PKC?-regulated pathway.
25372487 2014 [Pt(O,O'-acac)(?-acac)(DMS)] alters SH-SY5Y cell migration and invasion by the inhibition of Na+/H+ exchanger isoform 1 occurring through a PKC-?/ERK/mTOR Pathway.
25322815 2015 Distinct contribution of protein kinase C? and protein kinase C? in the lifespan and immune response of human blood monocyte subpopulations.
25308712 2015 MicroRNA-146a controls Th1-cell differentiation of human CD4+ T lymphocytes by targeting PRKC?.
25245533 2014 Interleukin-32? downregulates the activity of the B-cell CLL/lymphoma 6 protein by inhibiting protein kinase C?-dependent SUMO-2 modification.