Property Summary

Ligand Count 6
NCBI Gene PubMed Count 28
PubMed Score 29.30
PubTator Score 3.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Clostridium difficile colitis 12 3.267 1.6

Expression

  Differential Expression (26)

Disease log2 FC p
acute myeloid leukemia -1.400 4.0e-02
adult high grade glioma -2.900 2.6e-07
astrocytic glioma -2.700 3.2e-03
Astrocytoma, Pilocytic -2.000 3.0e-09
atypical teratoid / rhabdoid tumor -3.000 4.1e-08
colon cancer -1.800 6.8e-03
ependymoma -3.200 4.5e-03
gastric carcinoma 1.800 1.2e-02
glioblastoma -2.100 2.3e-08
group 3 medulloblastoma -2.800 6.2e-05
interstitial cystitis 1.500 4.4e-03
intraductal papillary-mucinous adenoma (... -2.900 2.1e-04
intraductal papillary-mucinous carcinoma... -2.700 7.4e-04
lung cancer -1.500 1.9e-02
malignant mesothelioma -3.400 1.0e-08
medulloblastoma, large-cell -3.800 8.0e-06
oligodendroglioma -1.900 1.7e-02
ovarian cancer 2.000 1.2e-05
pancreatic cancer 1.400 7.7e-04
pancreatic carcinoma 1.400 7.7e-04
Parkinson's disease -1.100 3.1e-02
Pick disease -1.400 3.0e-03
primary Sjogren syndrome 1.100 2.0e-03
primitive neuroectodermal tumor -3.000 2.6e-03
tuberculosis 1.100 1.3e-02
ulcerative colitis 1.600 1.2e-03

Protein-protein Interaction (8)

Gene RIF (13)

AA Sequence

MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMF      1 - 70
GKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSERE     71 - 140
GLQDIVIGIIKTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKESKEEDFYEDLDRFEENGTQESRISP    141 - 210
YTFCKAFPFHIIFDRDLVVTQCGNAIYRVLPQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTVFVLRS    211 - 280
KEGLLDVEKLECEDELTGTEISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATR    281 - 350
DLVLLGEQFREEYKLTQELEILTDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAKRYDNV    351 - 420
TILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEPCI    421 - 490
HHARSICHLALDMMEIAGQVQVDGESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKG    491 - 560
KINVSEYTYRCLMSPENSDPQFHLEHRGPVSMKGKKEPMQVWFLSRKNTGTEETKQDDD               561 - 619
//

Text Mined References (31)

PMID Year Title