Property Summary

NCBI Gene PubMed Count 27
Grant Count 5
R01 Count 5
Funding $754,350.87
PubMed Score 28.56
PubTator Score 3.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Synonym

Accession Q02153 B7Z426 Q86WY5 GCS-beta-1
Symbols GUCB3
GC-SB3
GUC1B3
GUCSB3
GUCY1B1
GC-S-beta-1

Gene

PANTHER Protein Class (3)

PDB

2WZ1   3UVJ   4NI2  

Gene RIF (12)

PMID Text
26876536 The kinetics of heme loss from oxidized sGC was monitored by a new method based on the heme group de-quenching the fluorescence of FlAsH-EDT2.
24733395 Dynamic interplay between hsp90, apo-sGC-beta1, and sGC-alpha1 in response to NO is unprecedented and represent new steps by which cells can modulate the heme content and activity of sGC for signaling cascades.
24666322 HIV-1 Tat potentiates NMDA-evoked (Ca2+)I responses involve LRP and a Src family kinase via the NOS/sGC/PKG pathway
23179318 Gene expression in dendritic cells of CCL5 and CXCL5 as well as TIMP1 and GUCY1B3 showed a significant increase within the first 4 days after trauma.
22690686 The G-protein regulator LGN modulates the activity of the NO receptor soluble guanylate cyclase
22426988 The results indicate that in comparison with the alpha-1 beta-1 isoform, the brain alpha-2 beta-1 isoform exhibits a distinctly different CO/NO affinity and binding rate in favor of NO signaling.
22223482 We concluded that the alpha-subunit and the beta(1)(191-619) domain exert structural strains on the heme domain.
21858179 Data show that show that it is possible to directly monitor the sGC haem oxidation state in intact cells. By inserting the TC motif into the coding sequence of the beta1 subunit of sGC in transiently transfected Chinese hamster ovary cells.
20105301 The mutant analysis indicated an importance for not only certain dimerization residue positions, but also an important role for other faces of the coiled coil dimer which might perhaps interact with adjacent domains
20063108 recombinant soluble guanylate cyclase (sGC) beta1 subunit and truncated N-terminal fragments expressed in E. coli; studied interaction between NO and sGC and schematic mechanism was proposed; study provides insights into structure and NO-binding of sGC
More...

AA Sequence

MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMF      1 - 70
GKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSERE     71 - 140
GLQDIVIGIIKTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKESKEEDFYEDLDRFEENGTQESRISP    141 - 210
YTFCKAFPFHIIFDRDLVVTQCGNAIYRVLPQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTVFVLRS    211 - 280
KEGLLDVEKLECEDELTGTEISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATR    281 - 350
DLVLLGEQFREEYKLTQELEILTDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAKRYDNV    351 - 420
TILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEPCI    421 - 490
HHARSICHLALDMMEIAGQVQVDGESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKG    491 - 560
KINVSEYTYRCLMSPENSDPQFHLEHRGPVSMKGKKEPMQVWFLSRKNTGTEETKQDDD               561 - 619
//

Text Mined References (30)

PMID Year Title
26876536 2016 The molecular mechanism of heme loss from oxidized soluble guanylate cyclase induced by conformational change.
24733395 2014 Nitric oxide and heat shock protein 90 activate soluble guanylate cyclase by driving rapid change in its subunit interactions and heme content.
24669844 2014 Interfacial residues promote an optimal alignment of the catalytic center in human soluble guanylate cyclase: heterodimerization is required but not sufficient for activity.
23505436 2013 Crystal structures of the catalytic domain of human soluble guanylate cyclase.
23179318 2013 Subsequent gene expression pattern in dendritic cells following multiple trauma.
22690686 2012 The G-protein regulator LGN modulates the activity of the NO receptor soluble guanylate cyclase.
22426988 2012 Structural and functional insights into the heme-binding domain of the human soluble guanylate cyclase ?2 subunit and heterodimeric ?2?1.
22223482 2012 Quaternary structure controls ligand dynamics in soluble guanylate cyclase.
21909115 2011 Genetic variants in novel pathways influence blood pressure and cardiovascular disease risk.
21909110 2011 Genome-wide association study identifies six new loci influencing pulse pressure and mean arterial pressure.
More...