Property Summary

NCBI Gene PubMed Count 30
Grant Count 54
R01 Count 38
Funding $12,132,024.77
PubMed Score 283.23
PubTator Score 117.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 2.300 0.000
psoriasis -2.300 0.000
osteosarcoma -2.435 0.000
pancreatic ductal adenocarcinoma liver m... -2.146 0.001

Synonym

Accession Q02127 A8K8C8 Q6P176 DHOdehase
Symbols URA1
POADS
DHOdehase

Gene

PANTHER Protein Class (2)

PDB

1D3G   1D3H   2B0M   2BXV   2FPT   2FPV   2FPY   2FQI   2PRH   2PRL   2PRM   2WV8   3F1Q   3FJ6   3FJL   3G0U   3G0X   3KVJ   3KVK   3KVL   3KVM   3U2O   3W7R   3ZWS   3ZWT   4IGH   4JGD   4JS3   4JTS   4JTT   4JTU   4LS0   4LS1   4LS2   4OQV   4RK8   4RKA   4RLI   4RR4   4YLW   4ZL1   4ZMG   5HIN  

Gene RIF (16)

PMID Text
26086954 This is the first study to report on conformational changes of the HsDHODH N-terminal microdomain through a combination of CD and DEER spectroscopic techniques
23216091 Considering that pyrimidine deficiency alone does not induce craniofacial dysmorphism, the DHODH mutations may contribute to the Miller syndrome in part through somehow altered mitochondrial function.
22967083 The G202A and R346W mutation causes deficient protein stability, and the R135C mutation impairs the substrate-induced enzymatic activity, suggesting that impairment of DHODH activity is linked to the Miller syndrome phenotype.
22966891 Carriage of a six-marker DHODH haplotype was associated with a reduced treatment response (p = 0.008).
22692683 biallelic DHODH mutations in four unrelated families with typical clinical features of Miller syndrome.
21430780 DHODH inhibition led to a marked decrease in melanoma growth both in vitro and in xenograft studies
20877624 Observational study of gene-disease association. (HuGE Navigator)
20399851 required for N-(4-hydroxyphenyl)retinamide-induced reactive oxygen species production and apoptosis of cancer epithelial cells
20220176 DHODH recessively causes Miller syndrome.
19915526 Data confirmed the presence of DHODH mutations in families with Miller syndrome.
More...

AA Sequence

MAWRHLKKRAQDAVIILGGGGLLFASYLMATGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRA      1 - 70
RFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQ     71 - 140
AVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVV    141 - 210
NVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLI    211 - 280
VTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGAS    281 - 350
LVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR                             351 - 395
//

Text Mined References (34)

PMID Year Title
26086954 2015 Conformational changes of the HsDHODH N-terminal Microdomain via DEER Spectroscopy.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23216091 2013 Dihydro-orotate dehydrogenase is physically associated with the respiratory complex and its loss leads to mitochondrial dysfunction.
22967083 2012 Protein instability and functional defects caused by mutations of dihydro-orotate dehydrogenase in Miller syndrome patients.
22966891 2012 Association of DHODH haplotype variants and response to leflunomide treatment in rheumatoid arthritis.
22692683 2012 Miller (Genee-Wiedemann) syndrome represents a clinically and biochemically distinct subgroup of postaxial acrofacial dysostosis associated with partial deficiency of DHODH.
21430780 2011 DHODH modulates transcriptional elongation in the neural crest and melanoma.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
More...