Property Summary

Ligand Count 417
NCBI Gene PubMed Count 31
PubMed Score 295.76
PubTator Score 117.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count
Postaxial Acrofacial Dysostosis 1

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 2.300 4.3e-07
osteosarcoma -2.435 1.8e-07
pancreatic ductal adenocarcinoma liver m... -2.146 1.4e-03
psoriasis -2.300 1.0e-05

Gene RIF (17)

AA Sequence

MAWRHLKKRAQDAVIILGGGGLLFASYLMATGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRA      1 - 70
RFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQ     71 - 140
AVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVV    141 - 210
NVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLI    211 - 280
VTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGAS    281 - 350
LVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR                             351 - 395
//

Text Mined References (35)

PMID Year Title