Property Summary

NCBI Gene PubMed Count 29
Grant Count 5
R01 Count 5
Funding $754,350.87
PubMed Score 36.67
PubTator Score 12.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (53)

Disease Z-score Confidence
Moyamoya disease 9 4.204 2.1
Achalasia 11 3.287 1.6
Adenoid Cystic Carcinoma 99
Angina Pectoris Prevention 4
Angina pectoris 21
Blood pressure finding 56
Breast cancer 3,094
Carcinoma 2,147 1.0
Chronic heart failure 46
Colonic Neoplasms 126
Controlled Hypotension 6
Coronary artery disease 240
Decompensated cardiac failure 9
Essential Hypertension 82 2.0
Hypertensive disease 193
Hypertensive disorder 58
Hypertensive urgency 10
Left ventricular cardiac dysfunction 9
MOYAMOYA DISEASE 6 WITH ACHALASIA 1
MYOCARDIAL INFARCTION, SUSCEPTIBILITY TO... 3 
Malignant essential hypertension 5
Perioperative hypertension 5
Persistent pulmonary hypertension of the... 8 
Pick disease 1,893
Pulmonary hypertension 52
Salivary Gland Neoplasms 45
Systemic arterial pressure 56
Thrombosis 42
adult high grade glioma 2,148
astrocytic glioma 2,241
atypical teratoid / rhabdoid tumor 4,369
breast carcinoma 1,614
colon cancer 1,475
gastric carcinoma 832
glioblastoma 5,572
interstitial cystitis 2,299
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
lung cancer 4,466
medulloblastoma 1,524
medulloblastoma, large-cell 6,234
non-small cell lung cancer 2,798
osteosarcoma 7,933
ovarian cancer 8,484
pancreatic cancer 2,300
pancreatic carcinoma 567
pilocytic astrocytoma 3,086
posterior fossa group B ependymoma 1,530
primary pancreatic ductal adenocarcinoma 1,271
progressive supranuclear palsy 674
spina bifida 1,064
tuberculosis 1,557
ulcerative colitis 2,087

Expression

  Differential Expression (27)

Disease log2 FC p
pancreatic cancer 1.200 0.003
astrocytic glioma -2.200 0.004
glioblastoma -2.000 0.002
osteosarcoma 1.309 0.041
posterior fossa group B ependymoma -2.300 0.000
medulloblastoma -2.400 0.000
atypical teratoid / rhabdoid tumor -2.600 0.000
medulloblastoma, large-cell -2.400 0.003
tuberculosis 1.100 0.001
primary pancreatic ductal adenocarcinoma 1.115 0.040
non-small cell lung cancer -1.203 0.000
intraductal papillary-mucinous adenoma (... -3.400 0.000
intraductal papillary-mucinous carcinoma... -3.400 0.000
lung cancer -2.700 0.000
colon cancer -2.100 0.020
interstitial cystitis 1.700 0.000
adult high grade glioma -2.000 0.001
pilocytic astrocytoma -1.200 0.008
pancreatic carcinoma 1.200 0.003
breast carcinoma -1.200 0.000
spina bifida -1.589 0.040
Pick disease 1.200 0.004
progressive supranuclear palsy 1.200 0.045
Breast cancer -2.100 0.000
gastric carcinoma 2.500 0.009
ulcerative colitis 1.700 0.002
ovarian cancer 1.200 0.000

Synonym

Accession Q02108 D3DP19 D6RDW3 O43843 Q8TAH3 GCS-alpha-3
Symbols GUCA3
MYMY6
GC-SA3
GUC1A3
GUCSA3
GUCY1A1

Gene

PANTHER Protein Class (3)

PDB

3UVJ   4NI2  

Gene RIF (14)

PMID Text
25373139 Expression of the alpha1-A680T sGC variant in reporter cells resulted in higher cyclic guanosine monophosphate production compared with the wild-type enzyme and the purified alpha1-A680T sGC exhibited enhanced sensitivity to nitric oxide in vitro.
24733395 Dynamic interplay between hsp90, apo-sGC-beta1, and sGC-alpha1 in response to NO is unprecedented and represent new steps by which cells can modulate the heme content and activity of sGC for signaling cascades.
24666322 HIV-1 Tat potentiates NMDA-evoked (Ca2+)I responses involve LRP and a Src family kinase via the NOS/sGC/PKG pathway
24581742 homozygous mutations in GUCY1A3, which encodes the alpha1 subunit of soluble guanylate cyclase, the major receptor for nitric oxide, might play a role in moyamoya and achalasia
24236047 ZNF280B upregulates GUCY1A3 expression and downregulates TP53 in prostate cancer cells.
22690686 The G-protein regulator LGN modulates the activity of the NO receptor soluble guanylate cyclase
22223482 We concluded that the alpha-subunit and the beta(1)(191-619) domain exert structural strains on the heme domain.
22174378 GCS-alpha-1 regulation of p53 activity is important in prostate cancer biology and may represent an important mechanism of p53 down-regulation.
21794866 analysis of pharmacological response to direct sGC activators in coronary artery disease patients
21725643 A novel insight into the heme and NO/CO binding mechanism of the alpha subunit of human soluble guanylate cyclase
More...

AA Sequence

MFCTKLKDLKITGECPFSLLAPGQVPNESSEEAAGSSESCKATVPICQDIPEKNIQESLPQRKTSRSRVY      1 - 70
LHTLAESICKLIFPEFERLNVALQRTLAKHKIKESRKSLEREDFEKTIAEQAVAAGVPVEVIKESLGEEV     71 - 140
FKICYEEDENILGVVGGTLKDFLNSFSTLLKQSSHCQEAGKRGRLEDASILCLDKEDDFLHVYYFFPKRT    141 - 210
TSLILPGIIKAAAHVLYETEVEVSLMPPCFHNDCSEFVNQPYLLYSVHMKSTKPSLSPSKPQSSLVIPTS    211 - 280
LFCKTFPFHFMFDKDMTILQFGNGIRRLMNRRDFQGKPNFEEYFEILTPKINQTFSGIMTMLNMQFVVRV    281 - 350
RRWDNSVKKSSRVMDLKGQMIYIVESSAILFLGSPCVDRLEDFTGRGLYLSDIPIHNALRDVVLIGEQAR    351 - 420
AQDGLKKRLGKLKATLEQAHQALEEEKKKTVDLLCSIFPCEVAQQLWQGQVVQAKKFSNVTMLFSDIVGF    421 - 490
TAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVETIGDAYCVAGGLHKESDTHAVQIALMALKMMELS    491 - 560
DEVMSPHGEPIKMRIGLHSGSVFAGVVGVKMPRYCLFGNNVTLANKFESCSVPRKINVSPTTYRLLKDCP    561 - 630
GFVFTPRSREELPPNFPSEIPGICHFLDAYQQGTNSKPCFQKKDVEDGNANFLGKASGID              631 - 690
//

Text Mined References (31)

PMID Year Title
25373139 2014 ?1-A680T variant in GUCY1A3 as a candidate conferring protection from pulmonary hypertension among Kyrgyz highlanders.
25249183 2015 Genome-wide association study in Chinese identifies novel loci for blood pressure and hypertension.
24733395 2014 Nitric oxide and heat shock protein 90 activate soluble guanylate cyclase by driving rapid change in its subunit interactions and heme content.
24669844 2014 Interfacial residues promote an optimal alignment of the catalytic center in human soluble guanylate cyclase: heterodimerization is required but not sufficient for activity.
24581742 2014 Loss of ?1?1 soluble guanylate cyclase, the major nitric oxide receptor, leads to moyamoya and achalasia.
24236047 2013 Zinc Finger 280B regulates sGC?1 and p53 in prostate cancer cells.
23505436 2013 Crystal structures of the catalytic domain of human soluble guanylate cyclase.
22751097 2012 Genome-wide association study in Han Chinese identifies four new susceptibility loci for coronary artery disease.
22690686 2012 The G-protein regulator LGN modulates the activity of the NO receptor soluble guanylate cyclase.
22223482 2012 Quaternary structure controls ligand dynamics in soluble guanylate cyclase.
More...