Property Summary

NCBI Gene PubMed Count 44
PubMed Score 1073.13
PubTator Score 324.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
medulloblastoma, large-cell 1.200 3.4e-05
mucosa-associated lymphoid tissue lympho... 2.351 2.4e-02
osteosarcoma -6.769 1.5e-12
psoriasis -1.500 6.0e-11

Gene RIF (22)

AA Sequence

MRFTFPLMAIVLEIAMIVLFGLFVEYETDQTVLEQLNITKPTDMGIFFELYPLFQDVHVMIFVGFGFLMT      1 - 70
FLKKYGFSSVGINLLVAALGLQWGTIVQGILQSQGQKFNIGIKNMINADFSAATVLISFGAVLGKTSPTQ     71 - 140
MLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFGAYFGLAVAGILYRSGLRKGHENEESAYYSDLF    141 - 210
AMIGTLFLWMFWPSFNSAIAEPGDKQCRAIVNTYFSLAACVLTAFAFSSLVEHRGKLNMVHIQNATLAGG    211 - 280
VAVGTCADMAIHPFGSMIIGSIAGMVSVLGYKFLTPLFTTKLRIHDTCGVHNLHGLPGVVGGLAGIVAVA    281 - 350
MGASNTSMAMQAAALGSSIGTAVVGGLMTGLILKLPLWGQPSDQNCYDDSVYWKVPKTR               351 - 409
//

Text Mined References (48)

PMID Year Title