Property Summary

NCBI Gene PubMed Count 44
Grant Count 69
R01 Count 24
Funding $29,491,659.19
PubMed Score 1008.10
PubTator Score 324.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -6.769 0.000
medulloblastoma, large-cell 1.200 0.000
mucosa-associated lymphoid tissue lympho... 2.351 0.024
psoriasis -1.500 0.000

Synonym

Accession Q02094 B2R8T8 O43514 O43515 Q7L8L3 Q9H454
Symbols OHS
RH2
OHST
Rh50
CD241
RH50A
Rh50GP
SLC42A1

Gene

PANTHER Protein Class (2)

Gene RIF (22)

PMID Text
26354748 We characterized ammonia and ammonium (NH3/NH4 (+)) transport by the rhesus-associated (Rh) glycoproteins RhAG, Rhbg, and Rhcg expressed in Xenopus oocytes. We used ion-selective microelectrodes and two-electrode voltage clamp to measure changes in intracellular pH, surface pH, and whole cell currents induced by NH3/NH4 (+) and methyl amine/ammonium (MA/MA(+)).
26175207 novel allele in a Brazilian pregnant woman encoding the Rhnull phenotype due to a change in RHAG exon2 c.310C>T, which leads to a premature stop codon (Gln104Stop).
25296744 A new Rh null allele (RHAG*01N.13) of the regulator type found in a consanguineous French-speaking quebecers'family.
24077989 RhAG, RhBG and RhCG-exhibit significant permeability to NH3 and show for the first time that RhBG and RhCG can conduct CO2.
23417980 Data from differentiating cultured erythroid precursor cells suggest that RhAG knockdown abolishes Rh blood group expression (RhoD [ras homolog family member D]; ICAM4 [intercellular adhesion molecule 4]; CD47 Rh-related antigen) in erythroid cells.
22012326 Results provide new insights into the functional impact of the Phe65Ser mutation in RhAG.
21883272 Substitution of GPB with Gp.Mur significantly reduced the expression of Rh antigen and RhAG on the Mi.III(+/+) erythrocyte membrane
21849667 The results provide new insight into RhAG stomatocytosis mutant F65S as a combined loss-of-function/gain-of-function mutation for methylammonium/methylammonium+ transport
21682734 that the 672C>A missense mutation in the RHAG gene could result in Rh(null) of the regulator type, and the single-amino-acid change (Ser to Arg) might be critical for assembly of the Rh antigen complex within the membrane
19273840 gas channels exhibit selectivity for CO(2) vs. NH(3) permeability, demonstrating the sequence AQP4 congruent with AQP5 > AQP1 > AmtB > RhAG.
More...

AA Sequence

MRFTFPLMAIVLEIAMIVLFGLFVEYETDQTVLEQLNITKPTDMGIFFELYPLFQDVHVMIFVGFGFLMT      1 - 70
FLKKYGFSSVGINLLVAALGLQWGTIVQGILQSQGQKFNIGIKNMINADFSAATVLISFGAVLGKTSPTQ     71 - 140
MLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFGAYFGLAVAGILYRSGLRKGHENEESAYYSDLF    141 - 210
AMIGTLFLWMFWPSFNSAIAEPGDKQCRAIVNTYFSLAACVLTAFAFSSLVEHRGKLNMVHIQNATLAGG    211 - 280
VAVGTCADMAIHPFGSMIIGSIAGMVSVLGYKFLTPLFTTKLRIHDTCGVHNLHGLPGVVGGLAGIVAVA    281 - 350
MGASNTSMAMQAAALGSSIGTAVVGGLMTGLILKLPLWGQPSDQNCYDDSVYWKVPKTR               351 - 409
//

Text Mined References (47)

PMID Year Title
26354748 2015 Mechanisms of ammonia and ammonium transport by rhesus-associated glycoproteins.
26175207 2015 Novel RHAG allele encoding the Rh(null) phenotype in Brazil.
25296744 2015 A new Rhnull allele in francophone Quebecers.
24077989 2013 Relative CO?/NH? permeabilities of human RhAG, RhBG and RhCG.
23417980 2013 In vitro generated Rh(null) red cells recapitulate the in vivo deficiency: a model for rare blood group phenotypes and erythroid membrane disorders.
22012326 2012 Human RhAG ammonia channel is impaired by the Phe65Ser mutation in overhydrated stomatocytic red cells.
21883272 2012 Expression of the Rh/RhAG complex is reduced in Mi.III erythrocytes.
21849667 2011 Loss-of-function and gain-of-function phenotypes of stomatocytosis mutant RhAG F65S.
21682734 2011 A family study of the Chinese Rhnull individual of the regulator type: a novel single missense mutation identified in RHAG gene.
19744193 2010 A new blood group system, RHAG: three antigens resulting from amino acid substitutions in the Rh-associated glycoprotein.
More...