Property Summary

NCBI Gene PubMed Count 26
PubMed Score 774.38
PubTator Score 409.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
Breast cancer 3578 9.9e-07
osteosarcoma 7950 2.6e-06
ovarian cancer 8520 3.8e-04
astrocytoma 1146 9.1e-04
psoriasis 6694 1.7e-03
lung cancer 4740 1.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Retinitis pigmentosa 12 9 4.736 2.4
Dissociative disorder 4 3.005 1.5

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytoma 1.300 9.1e-04
Breast cancer -1.500 9.9e-07
lung cancer -1.100 1.4e-02
osteosarcoma -1.129 2.6e-06
ovarian cancer -1.100 3.8e-04
psoriasis 1.500 1.7e-03

Gene RIF (9)

AA Sequence

MSDPQTSMAATAAVSPSDYLQPAASTTQDSQPSPLALLAATCSKIGPPAVEAAVTPPAPPQPTPRKLVPI      1 - 70
KPAPLPLSPGKNSFGILSSKGNILQIQGSQLSASYPGGQLVFAIQNPTMINKGTRSNANIQYQAVPQIQA     71 - 140
SNSQTIQVQPNLTNQIQIIPGTNQAIITPSPSSHKPVPIKPAPIQKSSTTTTPVQSGANVVKLTGGGGNV    141 - 210
TLTLPVNNLVNASDTGAPTQLLTESPPTPLSKTNKKARKKSLPASQPPVAVAEQVETVLIETTADNIIQA    211 - 280
GNNLLIVQSPGGGQPAVVQQVQVVPPKAEQQQVVQIPQQALRVVQAASATLPTVPQKPSQNFQIQAAEPT    281 - 350
PTQVYIRTPSGEVQTVLVQDSPPATAAATSNTTCSSPASRAPHLSGTSKKHSAAILRKERPLPKIAPAGS    351 - 420
IISLNAAQLAAAAQAMQTININGVQVQGVPVTITNTGGQQQLTVQNVSGNNLTISGLSPTQIQLQMEQAL    421 - 490
AGETQPGEKRRRMACTCPNCKDGEKRSGEQGKKKHVCHIPDCGKTFRKTSLLRAHVRLHTGERPFVCNWF    491 - 560
FCGKRFTRSDELQRHARTHTGDKRFECAQCQKRFMRSDHLTKHYKTHLVTKNL                     561 - 613
//

Text Mined References (31)

PMID Year Title