Property Summary

NCBI Gene PubMed Count 24
Grant Count 83
R01 Count 60
Funding $16,348,548.67
PubMed Score 744.28
PubTator Score 409.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis 1.500 0.002
osteosarcoma -1.129 0.000
astrocytoma 1.300 0.001
lung cancer -1.100 0.014
ovarian cancer 1.200 0.012
Breast cancer -1.500 0.000

Synonym

Accession Q02086 A6NK74
Symbols

Gene

SP2

Gene RIF (8)

PMID Text
26431879 O-GlcNAc modification of Sp3 and Sp4, but not Sp2 transcription factors negatively regulates their transcriptional activities.
24623314 Sp2 is up-regulated in gastric cancer tissues
19834535 Observational study of gene-disease association. (HuGE Navigator)
19698806 Data show that three Sp1 motifs located between -148 and -42bp upstream of the first exon were important in basic as well as in DA-induced NSMase2 promoter activity.
19482358 Despite the absence of Sp2 in the 5'-upstream sequence of the human promoter, silencing of Sp2 by RNA interference clearly demonstrated that Sp2 is required for IFN-gamma-induced regulation of socs1 mRNA both in human and mouse.
18051367 HIV-1 Tat downregulates Sp2 transcription factor in HEK 293T cells
17071613 an SP2/KLF6 repression complex by SHP is required for farnesoid X receptor-induced endothelial cell migration
15788387 has an intimate part in transcriptional regulation of the lh receptor gene.

AA Sequence

MSDPQTSMAATAAVSPSDYLQPAASTTQDSQPSPLALLAATCSKIGPPAVEAAVTPPAPPQPTPRKLVPI      1 - 70
KPAPLPLSPGKNSFGILSSKGNILQIQGSQLSASYPGGQLVFAIQNPTMINKGTRSNANIQYQAVPQIQA     71 - 140
SNSQTIQVQPNLTNQIQIIPGTNQAIITPSPSSHKPVPIKPAPIQKSSTTTTPVQSGANVVKLTGGGGNV    141 - 210
TLTLPVNNLVNASDTGAPTQLLTESPPTPLSKTNKKARKKSLPASQPPVAVAEQVETVLIETTADNIIQA    211 - 280
GNNLLIVQSPGGGQPAVVQQVQVVPPKAEQQQVVQIPQQALRVVQAASATLPTVPQKPSQNFQIQAAEPT    281 - 350
PTQVYIRTPSGEVQTVLVQDSPPATAAATSNTTCSSPASRAPHLSGTSKKHSAAILRKERPLPKIAPAGS    351 - 420
IISLNAAQLAAAAQAMQTININGVQVQGVPVTITNTGGQQQLTVQNVSGNNLTISGLSPTQIQLQMEQAL    421 - 490
AGETQPGEKRRRMACTCPNCKDGEKRSGEQGKKKHVCHIPDCGKTFRKTSLLRAHVRLHTGERPFVCNWF    491 - 560
FCGKRFTRSDELQRHARTHTGDKRFECAQCQKRFMRSDHLTKHYKTHLVTKNL                     561 - 613
//

Text Mined References (29)

PMID Year Title
26431879 2015 O-GlcNAc modification of Sp3 and Sp4 transcription factors negatively regulates their transcriptional activities.
25416956 2014 A proteome-scale map of the human interactome network.
24623314 2014 miR-638 suppresses cell proliferation in gastric cancer by targeting Sp2.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
19698806 Transcriptional regulation of neutral sphingomyelinase 2 gene expression of a human breast cancer cell line, MCF-7, induced by the anti-cancer drug, daunorubicin.
19482358 2009 Sp2 regulates interferon-gamma-mediated socs1 gene expression.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...