Property Summary

NCBI Gene PubMed Count 17
Grant Count 22
R01 Count 6
Funding $5,199,808.82
PubMed Score 446.82
PubTator Score 52.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma -1.300 0.000
osteosarcoma -1.324 0.010
pancreatic ductal adenocarcinoma liver m... -1.474 0.001
tuberculosis and treatment for 3 months 2.400 0.000
colon cancer -2.300 0.001
lung cancer -1.700 0.000
interstitial cystitis 1.300 0.003
non primary Sjogren syndrome sicca 1.200 0.017
lung carcinoma 1.600 0.000
acute myeloid leukemia 1.200 0.022
ulcerative colitis -2.200 0.000
ovarian cancer 1.700 0.001

Gene RIF (7)

PMID Text
24741114 The results suggest that N-acylethanolamine acid amidase and protein tyrosine kinase 7 may be used as potential tissue biomarkers to avoid overtreatment of non-aggressive prostate cancer
22040171 MALDI-TOF MS analysis of the human NAAA zymogen (47.7 kDa) treated with peptide-N-glycosidase F (PNGase F) identified 4 glycosylation sites, and acid cleavage of the zymogen into alpha- and beta-subunits (14.6 and 33.3 kDa) activated the enzyme.
19014633 Observational study of gene-disease association. (HuGE Navigator)
18806270 These results showed that both N-acylethanolamine-hydrolysing acid amidase and fatty acid amide hydrolase are functionally active in human prostate cancer cells.
18020949 we describe the overexpression and processing of recombinant human acid ceramidase in insect cells, its purification and characterization
17980170 Asn-37, Asn-107, Asn-309, and Asn-333 are actual N-glycosylation sites. The glycosylation appeared to play an important role in stabilizing the enzyme protein.
15610181 The level and activity of acid ceramidase in Alzheimer disease (AD) brain may play a role in controlling neuronal apoptosis and may mediate signalling pathways involved in the molecular mechanism of AD.

AA Sequence

MRTADREARPGLPSLLLLLLAGAGLSAASPPAAPRFNVSLDSVPELRWLPVLRHYDLDLVRAAMAQVIGD      1 - 70
RVPKWVHVLIGKVVLELERFLPQPFTGEIRGMCDFMNLSLADCLLVNLAYESSVFCTSIVAQDSRGHIYH     71 - 140
GRNLDYPFGNVLRKLTVDVQFLKNGQIAFTGTTFIGYVGLWTGQSPHKFTVSGDERDKGWWWENAIAALF    141 - 210
RRHIPVSWLIRATLSESENFEAAVGKLAKTPLIADVYYIVGGTSPREGVVITRNRDGPADIWPLDPLNGA    211 - 280
WFRVETNYDHWKPAPKEDDRRTSAIKALNATGQANLSLEALFQILSVVPVYNNFTIYTTVMSAGSPDKYM    281 - 350
TRIRNPSRK                                                                 351 - 359
//

Text Mined References (18)

PMID Year Title
24741114 2014 Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22040171 2012 Mass spectrometric characterization of human N-acylethanolamine-hydrolyzing acid amidase.
21106534 2011 The tumor suppressor hTid1 inhibits STAT5b activity via functional interaction.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19014633 2008 Lack of association of genetic variants in genes of the endocannabinoid system with anorexia nervosa.
18806270 2008 Expression and secretion of N-acylethanolamine-hydrolysing acid amidase in human prostate cancer cells.
18020949 2007 Overexpression and mass spectrometry analysis of mature human acid ceramidase.
17980170 2007 Proteolytic activation and glycosylation of N-acylethanolamine-hydrolyzing acid amidase, a lysosomal enzyme involved in the endocannabinoid metabolism.
More...