Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.42
PubTator Score 2.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Gene RIF (2)

AA Sequence

MASRKTKKKEGGALRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDLKDTYASLGKTNVKDD      1 - 70
ELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGKGKINKEYIKRLLMSQADKMTAEE     71 - 140
VDQMFQFASIDVAGNLDYKALSYVITHGEEKEE                                         141 - 173
//

Text Mined References (6)

PMID Year Title