Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.41
PubTator Score 2.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
Duchenne muscular dystrophy 602 1.70850825971376E-9
limb girdle muscular dystrophy 2A 156 3.22208944397069E-6
Amyotrophic Lateral Sclerosis 432 2.52864958233778E-4
Becker muscular dystrophy 187 3.67403068763154E-4
subependymal giant cell astrocytoma 2287 0.00619437473230955
osteosarcoma 7933 0.00927695274847205
non primary Sjogren syndrome sicca 840 0.0179372966308494

Expression

Synonym

Accession Q02045 Q8IXL8
Symbols

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19794400 Treatment of human brain endothelial cells with Tat markedly elevates GTP-RhoA levels and the potential downstream effectors, such as myosin phosphatase target subunit 1 and myosin light chain

AA Sequence

MASRKTKKKEGGALRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDLKDTYASLGKTNVKDD      1 - 70
ELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGKGKINKEYIKRLLMSQADKMTAEE     71 - 140
VDQMFQFASIDVAGNLDYKALSYVITHGEEKEE                                         141 - 173
//

Text Mined References (6)

PMID Year Title
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10722873 2000 Myosins: a diverse superfamily.
1284596 1992 The genomic organization of a novel regulatory myosin light chain gene (MYL5) that maps to chromosome 4p16.3 and shows different patterns of expression between primates.