Property Summary

NCBI Gene PubMed Count 67
Grant Count 169
R01 Count 95
Funding $14,486,540.35
PubMed Score 373.68
PubTator Score 187.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q01995 O15542
Symbols SM22
SMCC
TAGLN1
WS3-10

Gene

Gene RIF (49)

PMID Text
26847345 Increases or decreases in transgelin levels have reciprocal effects on tumor cell behavior, with higher expression promoting metastasis
26694173 activated AKT and JNK signaling pathways promote the overexpression of transgelin
26344167 Cofilin-1 and transgelin may play roles in the carcinogenesis and development of esophageal squamous cell carcinoma
26242444 Both tissue and salivary transgelin mRNA were closely correlated with various important clinicopathological parameters and were independent prognosis factors for oral squamous cell carcinoma.
25937534 SM22alpha is a phosphorylation-regulated suppressor of IKK-IkappaBalpha-NF-kappaB signaling cascades.
25917318 EZH2 regulates the chromatin structure at the TAGLN promoter through tri-methylation of H3K27, acting as an epigenetic integrator of IL-1beta and TGFbeta2 signaling.
25841305 Transgelin may be an excellent diagnostic marker of Triple negative tumors and could be useful in stratification of patients
25318625 Results indicate that miR-144 may regulate osteosarcoma cell proliferation and invasion by downregulating its target gene, transgelin protein (TAGLN), suggesting that miR-144 may be a potential therapeutic target for the treatment of osteosarcoma.
25109740 TAGLN was highly expressed in NF1-deficient malignant peripheral nerve sheath tumors compared to NF1-deficient plexiform neurofibromas. Upregulation was caused by increased transcriptional expression. The TAGLN gene was hypomethylated in the MPNST cells.
24938684 our data suggest that TAGLN may be a viable therapeutic target and a potential biomarker for predicting the prognosis of patients with lung adenocarcinoma.
More...

AA Sequence

MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLY      1 - 70
PDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTK     71 - 140
NDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS             141 - 201
//

Text Mined References (72)

PMID Year Title
26847345 2016 Transgelin increases metastatic potential of colorectal cancer cells in vivo and alters expression of genes involved in cell motility.
26694173 2016 AKT and JNK Signaling Pathways Increase the Metastatic Potential of Colorectal Cancer Cells by Altering Transgelin Expression.
26344167 2015 Expression of Cofilin-1 and Transgelin in Esophageal Squamous Cell Carcinoma.
26242444 2015 Increased Expression of Tissue/Salivary Transgelin mRNA Predicts Poor Prognosis in Patients with Oral Squamous Cell Carcinoma (OSCC).
25937534 2015 SM22? inhibits vascular inflammation via stabilization of I?B? in vascular smooth muscle cells.
25917318 2015 Enhancer of zeste homolog-2 (EZH2) methyltransferase regulates transgelin/smooth muscle-22? expression in endothelial cells in response to interleukin-1? and transforming growth factor-?2.
25841305 2015 Transgelin: a potentially useful diagnostic marker differentially expressed in triple-negative and non-triple-negative breast cancers.
25318625 2014 The downregulation of miR-144 is associated with the growth and invasion of osteosarcoma cells through the regulation of TAGLN expression.
25109740 2014 TAGLN expression is upregulated in NF1-associated malignant peripheral nerve sheath tumors by hypomethylation in its promoter and subpromoter regions.
24938684 2014 Transgelin overexpression in lung adenocarcinoma is associated with tumor progression.
More...