Property Summary

NCBI Gene PubMed Count 67
PubMed Score 373.68
PubTator Score 187.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
periodontitis 269 5.0098723065006E-18
breast carcinoma 1614 4.10963537885846E-14
Breast cancer 3099 3.23735189925881E-12
lung carcinoma 2844 2.43842635233251E-7
primary pancreatic ductal adenocarcinoma 1271 4.5193296151614E-6
malignant mesothelioma 3163 1.05720230870155E-5
ovarian cancer 8492 3.46341218632376E-5
pancreatic cancer 2300 3.99623623565026E-5
posterior fossa group A ependymoma 1511 1.455581047709E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 1.50567577374266E-4
adrenocortical carcinoma 1427 2.19449201164723E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 2.88640496188037E-4
acute quadriplegic myopathy 1157 5.03334195233421E-4
colon cancer 1475 6.06489293672887E-4
group 4 medulloblastoma 1875 0.00159308541607467
Duchenne muscular dystrophy 602 0.00160540359534572
psoriasis 6685 0.00333418511355013
limb girdle muscular dystrophy 2A 156 0.00418650599541214
pterygium 74 0.00420548167160317
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00421141884764651
cystic fibrosis 1670 0.00642181295006525
Becker muscular dystrophy 187 0.00833174210601156
nephrosclerosis 329 0.00993258742853938
invasive ductal carcinoma 2950 0.014295421689914
glioblastoma 5572 0.0145616485653115
pituitary cancer 1972 0.0156352928520612
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.0207436434540882
Pick disease 1893 0.037113787657805
urothelial carcinoma 318 0.0375135032334526
spina bifida 1064 0.0390983497807602
diabetes mellitus 1663 0.0491291193657598
Disease Target Count Z-score Confidence
Cardiovascular system disease 194 0.0 2.0

Expression

Synonym

Accession Q01995 O15542
Symbols SM22
SMCC
TAGLN1
WS3-10

Gene

  Ortholog (12)

Gene RIF (49)

PMID Text
26847345 Increases or decreases in transgelin levels have reciprocal effects on tumor cell behavior, with higher expression promoting metastasis
26694173 activated AKT and JNK signaling pathways promote the overexpression of transgelin
26344167 Cofilin-1 and transgelin may play roles in the carcinogenesis and development of esophageal squamous cell carcinoma
26242444 Both tissue and salivary transgelin mRNA were closely correlated with various important clinicopathological parameters and were independent prognosis factors for oral squamous cell carcinoma.
25937534 SM22alpha is a phosphorylation-regulated suppressor of IKK-IkappaBalpha-NF-kappaB signaling cascades.
25917318 EZH2 regulates the chromatin structure at the TAGLN promoter through tri-methylation of H3K27, acting as an epigenetic integrator of IL-1beta and TGFbeta2 signaling.
25841305 Transgelin may be an excellent diagnostic marker of Triple negative tumors and could be useful in stratification of patients
25318625 Results indicate that miR-144 may regulate osteosarcoma cell proliferation and invasion by downregulating its target gene, transgelin protein (TAGLN), suggesting that miR-144 may be a potential therapeutic target for the treatment of osteosarcoma.
25109740 TAGLN was highly expressed in NF1-deficient malignant peripheral nerve sheath tumors compared to NF1-deficient plexiform neurofibromas. Upregulation was caused by increased transcriptional expression. The TAGLN gene was hypomethylated in the MPNST cells.
24938684 our data suggest that TAGLN may be a viable therapeutic target and a potential biomarker for predicting the prognosis of patients with lung adenocarcinoma.
More...

AA Sequence

MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLY      1 - 70
PDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTK     71 - 140
NDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS             141 - 201
//

Text Mined References (72)

PMID Year Title
26847345 2016 Transgelin increases metastatic potential of colorectal cancer cells in vivo and alters expression of genes involved in cell motility.
26694173 2016 AKT and JNK Signaling Pathways Increase the Metastatic Potential of Colorectal Cancer Cells by Altering Transgelin Expression.
26344167 2015 Expression of Cofilin-1 and Transgelin in Esophageal Squamous Cell Carcinoma.
26242444 2015 Increased Expression of Tissue/Salivary Transgelin mRNA Predicts Poor Prognosis in Patients with Oral Squamous Cell Carcinoma (OSCC).
25937534 2015 SM22? inhibits vascular inflammation via stabilization of I?B? in vascular smooth muscle cells.
25917318 2015 Enhancer of zeste homolog-2 (EZH2) methyltransferase regulates transgelin/smooth muscle-22? expression in endothelial cells in response to interleukin-1? and transforming growth factor-?2.
25841305 2015 Transgelin: a potentially useful diagnostic marker differentially expressed in triple-negative and non-triple-negative breast cancers.
25318625 2014 The downregulation of miR-144 is associated with the growth and invasion of osteosarcoma cells through the regulation of TAGLN expression.
25109740 2014 TAGLN expression is upregulated in NF1-associated malignant peripheral nerve sheath tumors by hypomethylation in its promoter and subpromoter regions.
24938684 2014 Transgelin overexpression in lung adenocarcinoma is associated with tumor progression.
More...