Property Summary

NCBI Gene PubMed Count 80
PubMed Score 384.66
PubTator Score 187.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 3.0
Disease Target Count Z-score Confidence
Cancer 2499 4.271 2.1
Atherosclerosis 291 3.444 1.7
Hypertension 396 3.103 1.6

Expression

  Differential Expression (32)

Disease log2 FC p
Endometriosis -1.339 3.1e-02
acute quadriplegic myopathy 1.282 5.0e-04
adrenocortical carcinoma -2.168 1.6e-04
autosomal dominant Emery-Dreifuss muscul... 1.163 2.1e-02
Becker muscular dystrophy 1.383 8.3e-03
Breast cancer -1.900 1.2e-28
breast carcinoma -1.200 6.0e-10
colon cancer -3.700 6.1e-04
cystic fibrosis -1.034 1.9e-04
diabetes mellitus -1.100 4.9e-02
Duchenne muscular dystrophy 1.021 1.6e-03
glioblastoma 3.500 1.5e-02
group 4 medulloblastoma -1.600 1.6e-03
intraductal papillary-mucinous adenoma (... -1.800 1.5e-05
intraductal papillary-mucinous carcinoma... -2.000 3.1e-05
intraductal papillary-mucinous neoplasm ... -2.000 4.8e-04
invasive ductal carcinoma -1.300 2.6e-02
limb girdle muscular dystrophy 2A 1.171 4.2e-03
lung carcinoma -1.100 2.4e-07
malignant mesothelioma -1.100 1.1e-05
nephrosclerosis 1.168 9.9e-03
ovarian cancer -1.300 4.6e-02
pancreatic cancer 4.100 4.0e-05
periodontitis 1.200 5.0e-18
Pick disease 1.300 3.7e-02
pituitary cancer -1.300 1.6e-02
posterior fossa group A ependymoma 1.500 8.5e-05
primary pancreatic ductal adenocarcinoma 4.067 4.5e-06
psoriasis -1.300 3.3e-03
pterygium 1.800 4.2e-03
spina bifida -1.720 3.9e-02
urothelial carcinoma 2.800 3.8e-02

Gene RIF (57)

AA Sequence

MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLY      1 - 70
PDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTK     71 - 140
NDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS             141 - 201
//

Text Mined References (85)

PMID Year Title