Property Summary

NCBI Gene PubMed Count 88
Grant Count 48
R01 Count 28
Funding $3,154,684.99
PubMed Score 79.91
PubTator Score 131.18

Knowledge Summary

Patent (9,472)

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma -2.000 0.000
posterior fossa group B ependymoma 4.100 0.000
sonic hedgehog group medulloblastoma 2.200 0.000
cystic fibrosis -1.592 0.001
Hydrolethalus syndrome -1.212 0.045
ovarian cancer 1.400 0.004
psoriasis -1.100 0.000

Gene RIF (70)

PMID Text
26862065 the b-catenin-independent WNT score correlated with reduced overall survival only in the metastasized situation . This is in line with the in vitro results of the alternative WNT receptors ROR1 and ROR2, which foster invasion
26771355 Data show that CD13 anntigen and receptor tyrosine kinase-like orphan receptor 2 (ROR2) identify a cardiac lineage precursor pool that is capable of successful engraftment into the porcine heart.
26708384 Wnt5a-Ror2 signaling enhances expression and secretion of CXCL16 in mesenchymal stem cells thereby activating CXCR6 expressed on tumor cells to promote proliferation.
26690702 This study identifies an interaction between ROR1 and ROR2 that is required for Wnt5a signaling that promotes leukemia chemotaxis and proliferation.
26596412 results corroborated previous findings of Ryk-mediated Wnt5a effect, and suggested a role for Ror2 in the Wnt5a machinery in glioblastoma
26559837 These data suggest a mechanism where human cytomegalovirus alters the expression of the Wnt receptor ROR2 to alter Wnt5a-mediated signaling and inhibit trophoblast motility
26515598 Data show that silencing receptor tyrosine kinases (RTKs) ROR2 and ROR1 has a strong inhibitory effect on the ability of ovarian cancer cells to proliferate, migrate and invade.
26305508 Findings suggest that high receptor tyrosine kinase-like orphan receptor (ROR) 2 or proto-oncogene protein Wnt-5A (Wnt5a) expression is associated with poor prognosis in non-small cell lung cancer (NSCLC).
26284319 ROR2 gene mutations are associated with autosomal recessive robinow syndrome.
26259918 We present strong evidence that ROR2 could be used as an indicator of poor prognosis and could represent a novel therapeutic target for PDAC.
More...

AA Sequence

MARGSALPRRPLLCIPAVWAAAALLLSVSRTSGEVEVLDPNDPLGPLDGQDGPIPTLKGYFLNFLEPVNN      1 - 70
ITIVQGQTAILHCKVAGNPPPNVRWLKNDAPVVQEPRRIIIRKTEYGSRLRIQDLDTTDTGYYQCVATNG     71 - 140
MKTITATGVLFVRLGPTHSPNHNFQDDYHEDGFCQPYRGIACARFIGNRTIYVDSLQMQGEIENRITAAF    141 - 210
TMIGTSTHLSDQCSQFAIPSFCHFVFPLCDARSRTPKPRELCRDECEVLESDLCRQEYTIARSNPLILMR    211 - 280
LQLPKCEALPMPESPDAANCMRIGIPAERLGRYHQCYNGSGMDYRGTASTTKSGHQCQPWALQHPHSHHL    281 - 350
SSTDFPELGGGHAYCRNPGGQMEGPWCFTQNKNVRMELCDVPSCSPRDSSKMGILYILVPSIAIPLVIAC    351 - 420
LFFLVCMCRNKQKASASTPQRRQLMASPSQDMEMPLINQHKQAKLKEISLSAVRFMEELGEDRFGKVYKG    421 - 490
HLFGPAPGEQTQAVAIKTLKDKAEGPLREEFRHEAMLRARLQHPNVVCLLGVVTKDQPLSMIFSYCSHGD    491 - 560
LHEFLVMRSPHSDVGSTDDDRTVKSALEPPDFVHLVAQIAAGMEYLSSHHVVHKDLATRNVLVYDKLNVK    561 - 630
ISDLGLFREVYAADYYKLLGNSLLPIRWMAPEAIMYGKFSIDSDIWSYGVVLWEVFSYGLQPYCGYSNQD    631 - 700
VVEMIRNRQVLPCPDDCPAWVYALMIECWNEFPSRRPRFKDIHSRLRAWGNLSNYNSSAQTSGASNTTQT    701 - 770
SSLSTSPVSNVSNARYVGPKQKAPPFPQPQFIPMKGQIRPMVPPPQLYVPVNGYQPVPAYGAYLPNFYPV    771 - 840
QIPMQMAPQQVPPQMVPKPSSHHSGSGSTSTGYVTTAPSNTSMADRAALLSEGADDTQNAPEDGAQSTVQ    841 - 910
EAEEEEEGSVPETELLGDCDTLQVDEAQVQLEA                                         911 - 943
//

Text Mined References (89)

PMID Year Title
26862065 2016 ?-catenin-independent WNT signaling and Ki67 in contrast to the estrogen receptor status are prognostic and associated with poor prognosis in breast cancer liver metastases.
26771355 2016 CD13 and ROR2 Permit Isolation of Highly Enriched Cardiac Mesoderm from Differentiating Human Embryonic Stem Cells.
26708384 2016 Wnt5a-Ror2 signaling in mesenchymal stem cells promotes proliferation of gastric cancer cells by activating CXCL16-CXCR6 axis.
26690702 2016 Wnt5a induces ROR1/ROR2 heterooligomerization to enhance leukemia chemotaxis and proliferation.
26596412 2015 Wnt5a, Ryk and Ror2 expression in glioblastoma subgroups.
26559837 2015 Human Cytomegalovirus Modulates Expression of Noncanonical Wnt Receptor ROR2 To Alter Trophoblast Migration.
26515598 2015 Targeting the ROR1 and ROR2 receptors in epithelial ovarian cancer inhibits cell migration and invasion.
26305508 2015 Over-expression of ROR2 and Wnt5a cooperatively correlates with unfavorable prognosis in patients with non-small cell lung cancer.
26284319 2015 Clinical and molecular characterization of seven Egyptian families with autosomal recessive robinow syndrome: Identification of four novel ROR2 gene mutations.
26259918 2015 High ROR2 expression in tumor cells and stroma is correlated with poor prognosis in pancreatic ductal adenocarcinoma.
More...