Property Summary

NCBI Gene PubMed Count 70
PubMed Score 30.70
PubTator Score 98.47

Knowledge Summary

Patent (22,774)

Expression

  Differential Expression (16)

Disease log2 FC p
active ulcerative colitis 1.645 3.9e-02
atypical teratoid / rhabdoid tumor 1.900 9.7e-03
Breast cancer -1.200 4.8e-05
Chronic Lymphocytic Leukemia 1.891 1.8e-07
cystic fibrosis -2.916 4.9e-06
ependymoma 1.800 9.4e-06
glioblastoma 1.300 1.2e-02
group 3 medulloblastoma 2.000 1.9e-03
intraductal papillary-mucinous adenoma (... 1.300 2.9e-04
lung adenocarcinoma -1.200 8.3e-15
lung carcinoma -2.500 1.0e-31
medulloblastoma, large-cell 2.700 1.7e-03
non-small cell lung cancer -1.532 1.7e-12
osteosarcoma 2.364 6.0e-04
ovarian cancer -3.100 7.8e-08
pituitary cancer 1.100 4.5e-03

Gene RIF (61)

AA Sequence

MHRPRRRGTRPPLLALLAALLLAARGAAAQETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTS      1 - 70
LGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVV     71 - 140
SSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIG    141 - 210
TSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLP    211 - 280
NCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTAL    281 - 350
RFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKMEILYILVPSVAIPLAIAL    351 - 420
LFFFICVCRNNQKSSSAPVQRQPKHVRGQNVEMSMLNAYKPKSKAKELPLSAVRFMEELGECAFGKIYKG    421 - 490
HLYLPGMDHAQLVAIKTLKDYNNPQQWTEFQQEASLMAELHHPNIVCLLGAVTQEQPVCMLFEYINQGDL    491 - 560
HEFLIMRSPHSDVGCSSDEDGTVKSSLDHGDFLHIAIQIAAGMEYLSSHFFVHKDLAARNILIGEQLHVK    561 - 630
ISDLGLSREIYSADYYRVQSKSLLPIRWMPPEAIMYGKFSSDSDIWSFGVVLWEIFSFGLQPYYGFSNQE    631 - 700
VIEMVRKRQLLPCSEDCPPRMYSLMTECWNEIPSRRPRFKDIHVRLRSWEGLSSHTSSTTPSGGNATTQT    701 - 770
TSLSASPVSNLSNPRYPNYMFPSQGITPQGQIAGFIGPPIPQNQRFIPINGYPIPPGYAAFPAAHYQPTG    771 - 840
PPRVIQHCPPPKSRSPSSASGSTSTGHVTSLPSSGSNQEANIPLLPHMSIPNHPGGMGITVFGNKSQKPY    841 - 910
KIDSKQASLLGDANIHGHTESMISAEL                                               911 - 937
//

Text Mined References (73)

PMID Year Title