Property Summary

NCBI Gene PubMed Count 52
Grant Count 21
R01 Count 20
Funding $2,202,348.69
PubMed Score 63.73
PubTator Score 68.50

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... 1.081 0.011

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
720704 screening 662 / 0 / 369614 Fluorescence-based biochemical high throughput primary assay to identify inhibitors of phospholipase C isozymes (PLC-beta3).
720731 summary 0 / 0 / 0 Summary of the probe development effort to identify inhibitors of phospholipase C isozymes (PLC-beta 3).
743261 screening 36 / 0 / 3228 Fluorescence-based biochemical high throughput confirmation assay to identify inhibitors of phospholipase C isozymes (PLC-B3)
743328 confirmatory 0 / 0 / 157 Fluorescence-based biochemical high throughput dose response assay to identify inhibitors of phospholipase C isozymes (PLC-B3)

Gene RIF (33)

PMID Text
26490115 the MCP1-induced cortactin phosphorylation is dependent on PLCb3-mediated PKC activation, and siRNA-mediated down-regulation of either of these molecules prevents cortactin interaction with WAVE2
26468229 Gnb isoforms control a signaling pathway comprising Rac1, Plcbeta2, and Plcbeta3 leading to LFA-1 activation and neutrophil arrest in vivo
25193662 membranes are integral for the activation of PLC-beta isozymes by diverse modulators.
24642259 This study provides an understanding of the structural basis for the PDZ-mediated NHERF1-PLCbeta3 interaction that could prove valuable in selective drug design against CXCR2-related cancers.
24596086 the M3 muscarinic receptor maximizes the efficiency of PLCbeta3 signaling beyond its canonical role as a guanine nucleotide exchange factor for Galpha.
23377541 phospholipase C-beta3 structure reveals the role of the its distal C-terminal domain
23006664 PLCbeta3 is enriched in the cytosol.
22728827 GPCR activation of Ras and PI3Kc in neutrophils depends on PLCb2/b3 and the RasGEF RasGRP4.
22528496 PDZ domain-containing 1 (PDZK1) protein regulates phospholipase C-beta3 (PLC-beta3)-specific activation of somatostatin by forming a ternary complex with PLC-beta3 and somatostatin receptors.
21705626 Stromal cell-derived factor-1 signaling via the CXCR4-TCR heterodimer uses PLC-beta3 to activate the Ras-ERK pathway and increase intracellular calcium ion concentrations
More...

AA Sequence

MAGAQPGVHALQLEPPTVVETLRRGSKFIKWDEETSSRNLVTLRVDPNGFFLYWTGPNMEVDTLDISSIR      1 - 70
DTRTGRYARLPKDPKIREVLGFGGPDARLEEKLMTVVSGPDPVNTVFLNFMAVQDDTAKVWSEELFKLAM     71 - 140
NILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFSADKKRVETALESCGLKFNRSESIRPDEFSL    141 - 210
EIFERFLNKLCLRPDIDKILLEIGAKGKPYLTLEQLMDFINQKQRDPRLNEVLYPPLRPSQARLLIEKYE    211 - 280
PNQQFLERDQMSMEGFSRYLGGEENGILPLEALDLSTDMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMY    281 - 350
RQALLWGCRCVELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAK    351 - 420
QQAKMAEYCRSIFGDALLIEPLDKYPLAPGVPLPSPQDLMGRILVKNKKRHRPSAGGPDSAGRKRPLEQS    421 - 490
NSALSESSAATEPSSPQLGSPSSDSCPGLSNGEEVGLEKPSLEPQKSLGDEGLNRGPYVLGPADREDEEE    491 - 560
DEEEEEQTDPKKPTTDEGTASSEVNATEEMSTLVNYIEPVKFKSFEAARKRNKCFEMSSFVETKAMEQLT    561 - 630
KSPMEFVEYNKQQLSRIYPKGTRVDSSNYMPQLFWNVGCQLVALNFQTLDVAMQLNAGVFEYNGRSGYLL    631 - 700
KPEFMRRPDKSFDPFTEVIVDGIVANALRVKVISGQFLSDRKVGIYVEVDMFGLPVDTRRKYRTRTSQGN    701 - 770
SFNPVWDEEPFDFPKVVLPTLASLRIAAFEEGGKFVGHRILPVSAIRSGYHYVCLRNEANQPLCLPALLI    771 - 840
YTEASDYIPDDHQDYAEALINPIKHVSLMDQRARQLAALIGESEAQAGQETCQDTQSQQLGSQPSSNPTP    841 - 910
SPLDASPRRPPGPTTSPASTSLSSPGQRDDLIASILSEVAPTPLDELRGHKALVKLRSRQERDLRELRKK    911 - 980
HQRKAVTLTRRLLDGLAQAQAEGRCRLRPGALGGAADVEDTKEGEDEAKRYQEFQNRQVQSLLELREAQV    981 - 1050
DAEAQRRLEHLRQALQRLREVVLDANTTQFKRLKEMNEREKKELQKILDRKRHNSISEAKMRDKHKKEAE   1051 - 1120
LTEINRRHITESVNSIRRLEEAQKQRHDRLVAGQQQVLQQLAEEEPKLLAQLAQECQEQRARLPQEIRRS   1121 - 1190
LLGEMPEGLGDGPLVACASNGHAPGSSGHLSGADSESQEENTQL                             1191 - 1234
//

Text Mined References (63)

PMID Year Title
26490115 2015 PLC?3 mediates cortactin interaction with WAVE2 in MCP1-induced actin polymerization and cell migration.
26468229 2016 Gnb isoforms control a signaling pathway comprising Rac1, Plc?2, and Plc?3 leading to LFA-1 activation and neutrophil arrest in vivo.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25193662 2014 Membrane-induced allosteric control of phospholipase C-? isozymes.
24642259 2014 Crystallographic analysis of NHERF1-PLC?3 interaction provides structural basis for CXCR2 signaling in pancreatic cancer.
24596086 2014 M3 muscarinic receptor interaction with phospholipase C ?3 determines its signaling efficiency.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23377541 2013 Full-length G?(q)-phospholipase C-?3 structure reveals interfaces of the C-terminal coiled-coil domain.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...