Property Summary

Ligand Count 1,755
NCBI Gene PubMed Count 742
PubMed Score 3752.38
PubTator Score 2895.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (9)

Disease Target Count P-value
osteosarcoma 7950 9.4e-06
malignant mesothelioma 3232 3.3e-04
diabetes mellitus 1728 1.3e-03
group 3 medulloblastoma 4104 3.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Alcohol dependence 107 4.498 2.2
Disease Target Count Z-score Confidence
Dystonia 164 0.0 4.0
Neurodegenerative disease 414 0.0 4.0
Disease Target Count
Parkinson's disease 392

Expression

  Differential Expression (4)

Disease log2 FC p
diabetes mellitus 1.200 1.3e-03
group 3 medulloblastoma 2.100 3.5e-02
malignant mesothelioma 1.300 3.3e-04
osteosarcoma 1.338 9.4e-06

 GWAS Trait (1)

Gene RIF (861)

AA Sequence

MSKSKCSVGLMSSVVAPAKEPNAVGPKEVELILVKEQNGVQLTSSTLTNPRQSPVEAQDRETWGKKIDFL      1 - 70
LSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELALGQFNREGAAGVWKICPILKG     71 - 140
VGFTVILISLYVGFFYNVIIAWALHYLFSSFTTELPWIHCNNSWNSPNCSDAHPGDSSGDSSGLNDTFGT    141 - 210
TPAAEYFERGVLHLHQSHGIDDLGPPRWQLTACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTAL    211 - 280
LLRGVTLPGAIDGIRAYLSVDFYRLCEASVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAIVTT    281 - 350
SINSLTSFSSGFVVFSFLGYMAQKHSVPIGDVAKDGPGLIFIIYPEAIATLPLSSAWAVVFFIMLLTLGI    351 - 420
DSAMGGMESVITGLIDEFQLLHRHRELFTLFIVLATFLLSLFCVTNGGIYVFTLLDHFAAGTSILFGVLI    421 - 490
EAIGVAWFYGVGQFSDDIQQMTGQRPSLYWRLCWKLVSPCFLLFVVVVSIVTFRPPHYGAYIFPDWANAL    491 - 560
GWVIATSSMAMVPIYAAYKFCSLPGSFREKLAYAIAPEKDRELVDRGEVRQFTLRHWLKV              561 - 620
//

Text Mined References (743)

PMID Year Title