Property Summary

NCBI Gene PubMed Count 125
PubMed Score 204.39
PubTator Score 143.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Disease Target Count Z-score Confidence
Corneal disease 31 0.0 3.0
Disease Target Count Z-score Confidence
Keratoconus 113 3.213 1.6

Expression

  Differential Expression (21)

Disease log2 FC p
acute quadriplegic myopathy 1.571 2.5e-03
adrenocortical carcinoma -1.651 1.3e-05
adult high grade glioma 1.200 2.8e-03
Amyotrophic lateral sclerosis 1.326 2.1e-05
Astrocytoma, Pilocytic 1.100 1.8e-03
atypical teratoid / rhabdoid tumor 1.200 1.0e-03
Breast cancer -1.200 5.9e-04
dermatomyositis 2.000 1.0e-03
facioscapulohumeral dystrophy -1.700 3.5e-02
hepatocellular carcinoma -1.500 3.8e-03
interstitial cystitis 1.500 1.8e-02
intraductal papillary-mucinous neoplasm ... -2.200 6.0e-04
lung cancer -2.500 1.7e-04
lung carcinoma -1.300 2.6e-19
medulloblastoma, large-cell 1.500 1.9e-05
non-small cell lung cancer -1.877 2.0e-19
ovarian cancer -1.500 1.1e-03
Pick disease 1.400 2.9e-02
pituitary cancer -2.400 4.9e-07
posterior fossa group A ependymoma -1.100 2.6e-04
psoriasis -1.700 1.0e-03

Protein-protein Interaction (2)

Gene RIF (81)

AA Sequence

MSARTAPRPQVLLLPLLLVLLAAAPAASKGCVCKDKGQCFCDGAKGEKGEKGFPGPPGSPGQKGFTGPEG      1 - 70
LPGPQGPKGFPGLPGLTGSKGVRGISGLPGFSGSPGLPGTPGNTGPYGLVGVPGCSGSKGEQGFPGLPGT     71 - 140
LGYPGIPGAAGLKGQKGAPAKEEDIELDAKGDPGLPGAPGPQGLPGPPGFPGPVGPPGPPGFFGFPGAMG    141 - 210
PRGPKGHMGERVIGHKGERGVKGLTGPPGPPGTVIVTLTGPDNRTDLKGEKGDKGAMGEPGPPGPSGLPG    211 - 280
ESYGSEKGAPGDPGLQGKPGKDGVPGFPGSEGVKGNRGFPGLMGEDGIKGQKGDIGPPGFRGPTEYYDTY    281 - 350
QEKGDEGTPGPPGPRGARGPQGPSGPPGVPGSPGSSRPGLRGAPGWPGLKGSKGERGRPGKDAMGTPGSP    351 - 420
GCAGSPGLPGSPGPPGPPGDIVFRKGPPGDHGLPGYLGSPGIPGVDGPKGEPGLLCTQCPYIPGPPGLPG    421 - 490
LPGLHGVKGIPGRQGAAGLKGSPGSPGNTGLPGFPGFPGAQGDPGLKGEKGETLQPEGQVGVPGDPGLRG    491 - 560
QPGRKGLDGIPGTPGVKGLPGPKGELALSGEKGDQGPPGDPGSPGSPGPAGPAGPPGYGPQGEPGLQGTQ    561 - 630
GVPGAPGPPGEAGPRGELSVSTPVPGPPGPPGPPGHPGPQGPPGIPGSLGKCGDPGLPGPDGEPGIPGIG    631 - 700
FPGPPGPKGDQGFPGTKGSLGCPGKMGEPGLPGKPGLPGAKGEPAVAMPGGPGTPGFPGERGNSGEHGEI    701 - 770
GLPGLPGLPGTPGNEGLDGPRGDPGQPGPPGEQGPPGRCIEGPRGAQGLPGLNGLKGQQGRRGKTGPKGD    771 - 840
PGIPGLDRSGFPGETGSPGIPGHQGEMGPLGQRGYPGNPGILGPPGEDGVIGMMGFPGAIGPPGPPGNPG    841 - 910
TPGQRGSPGIPGVKGQRGTPGAKGEQGDKGNPGPSEISHVIGDKGEPGLKGFAGNPGEKGNRGVPGMPGL    911 - 980
KGLKGLPGPAGPPGPRGDLGSTGNPGEPGLRGIPGSMGNMGMPGSKGKRGTLGFPGRAGRPGLPGIHGLQ    981 - 1050
GDKGEPGYSEGTRPGPPGPTGDPGLPGDMGKKGEMGQPGPPGHLGPAGPEGAPGSPGSPGLPGKPGPHGD   1051 - 1120
LGFKGIKGLLGPPGIRGPPGLPGFPGSPGPMGIRGDQGRDGIPGPAGEKGETGLLRAPPGPRGNPGAQGA   1121 - 1190
KGDRGAPGFPGLPGRKGAMGDAGPRGPTGIEGFPGPPGLPGAIIPGQTGNRGPPGSRGSPGAPGPPGPPG   1191 - 1260
SHVIGIKGDKGSMGHPGPKGPPGTAGDMGPPGRLGAPGTPGLPGPRGDPGFQGFPGVKGEKGNPGFLGSI   1261 - 1330
GPPGPIGPKGPPGVRGDPGTLKIISLPGSPGPPGTPGEPGMQGEPGPPGPPGNLGPCGPRGKPGKDGKPG   1331 - 1400
TPGPAGEKGNKGSKGEPGPAGSDGLPGLKGKRGDSGSPATWTTRGFVFTRHSQTTAIPSCPEGTVPLYSG   1401 - 1470
FSFLFVQGNQRAHGQDLGTLGSCLQRFTTMPFLFCNVNDVCNFASRNDYSYWLSTPALMPMNMAPITGRA   1471 - 1540
LEPYISRCTVCEGPAIAIAVHSQTTDIPPCPHGWISLWKGFSFIMFTSAGSEGTGQALASPGSCLEEFRA   1541 - 1610
SPFLECHGRGTCNYYSNSYSFWLASLNPERMFRKPIPSTVKAGELEKIISRCQVCMKKRH             1611 - 1670
//

Text Mined References (126)

PMID Year Title