Property Summary

NCBI Gene PubMed Count 119
PubMed Score 190.32
PubTator Score 143.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
non-small cell lung cancer 2798 2.49814808854588E-24
lung carcinoma 2844 2.57275405749641E-19
pituitary cancer 1972 1.21939365425072E-8
lung cancer 4473 5.19288827307603E-7
Amyotrophic Lateral Sclerosis 432 3.26067576838893E-6
medulloblastoma, large-cell 6234 1.87100487809831E-5
adrenocortical carcinoma 1427 2.10693305533169E-5
posterior fossa group A ependymoma 1511 2.59884730013859E-4
Breast cancer 3099 5.88119039513328E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 6.01947289086314E-4
psoriasis 6685 0.00100976490843615
atypical teratoid / rhabdoid tumor 4369 0.00102972124652417
dermatomyositis 967 0.00104079246948189
ovarian cancer 8492 0.00107799689197048
acute quadriplegic myopathy 1157 0.00246840325734801
pilocytic astrocytoma 3086 0.00279675244130457
adult high grade glioma 2148 0.00280047443875445
hepatocellular carcinoma 550 0.00378633304794505
interstitial cystitis 2299 0.018133162383088
Pick disease 1893 0.0287969695344294
facioscapulohumeral dystrophy 286 0.0346710610795917
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Corneal disease 32 0.0 2.0

Expression

  Differential Expression (21)

Gene

  Ortholog (7)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid

Gene RIF (75)

PMID Text
26194984 Letter/Case Report: novel COL4A3 gene mutations in a consanguineous family with autosomal recessive Alport syndrome.
26138234 The results support the hypothesis that certain hypomorphic podocin variants may act as adverse genetic modifiers when co-inherited with COL4A3 mutations
25596306 COL4A3 mutations cause focal segmental glomerulosclerosis.
25575550 we identified seven families with associated mutations in COL4A3 and COL4A4 genes and four families with associated mutations in COL4A4 and COL4A5. We did not find kindreds with digenic inheritance attributable to mutations in COL4A3 and COL4A5
25514610 Functional studies in cultured podocytes transfected with wild type or mutant COL4A3 chains showed retention of mutant collagens and differential activation of the unfolded protein response cascade.
25450602 A new mutation in the COL4A3 gene responsible for autosomal dominant Alport syndrome, which only generates hearing loss in some carriers
25381091 In family 2, a novel COL4A3 missense mutation c.G2290A (p.Gly997Glu) was identified in all affected family members, who had disease ranging from isolated microscopic hematuria to end stage renal disease.
25307543 New COL4A3 mutations among Portuguese patients with collagen IV-related nephropathies were identified in 18 unrelated families.
25229338 We found that 7 out of 70 families (10%) with familial focal segmental glomerulosclerosis in our cohort have rare variants in COL4A3 and COL4A4.
25083577 We could hypothesize that mutations in COL4A3 and COL4A4 genes are not involved in keratoconus risk in Greek population.
More...

AA Sequence

MSARTAPRPQVLLLPLLLVLLAAAPAASKGCVCKDKGQCFCDGAKGEKGEKGFPGPPGSPGQKGFTGPEG      1 - 70
LPGPQGPKGFPGLPGLTGSKGVRGISGLPGFSGSPGLPGTPGNTGPYGLVGVPGCSGSKGEQGFPGLPGT     71 - 140
LGYPGIPGAAGLKGQKGAPAKEEDIELDAKGDPGLPGAPGPQGLPGPPGFPGPVGPPGPPGFFGFPGAMG    141 - 210
PRGPKGHMGERVIGHKGERGVKGLTGPPGPPGTVIVTLTGPDNRTDLKGEKGDKGAMGEPGPPGPSGLPG    211 - 280
ESYGSEKGAPGDPGLQGKPGKDGVPGFPGSEGVKGNRGFPGLMGEDGIKGQKGDIGPPGFRGPTEYYDTY    281 - 350
QEKGDEGTPGPPGPRGARGPQGPSGPPGVPGSPGSSRPGLRGAPGWPGLKGSKGERGRPGKDAMGTPGSP    351 - 420
GCAGSPGLPGSPGPPGPPGDIVFRKGPPGDHGLPGYLGSPGIPGVDGPKGEPGLLCTQCPYIPGPPGLPG    421 - 490
LPGLHGVKGIPGRQGAAGLKGSPGSPGNTGLPGFPGFPGAQGDPGLKGEKGETLQPEGQVGVPGDPGLRG    491 - 560
QPGRKGLDGIPGTPGVKGLPGPKGELALSGEKGDQGPPGDPGSPGSPGPAGPAGPPGYGPQGEPGLQGTQ    561 - 630
GVPGAPGPPGEAGPRGELSVSTPVPGPPGPPGPPGHPGPQGPPGIPGSLGKCGDPGLPGPDGEPGIPGIG    631 - 700
FPGPPGPKGDQGFPGTKGSLGCPGKMGEPGLPGKPGLPGAKGEPAVAMPGGPGTPGFPGERGNSGEHGEI    701 - 770
GLPGLPGLPGTPGNEGLDGPRGDPGQPGPPGEQGPPGRCIEGPRGAQGLPGLNGLKGQQGRRGKTGPKGD    771 - 840
PGIPGLDRSGFPGETGSPGIPGHQGEMGPLGQRGYPGNPGILGPPGEDGVIGMMGFPGAIGPPGPPGNPG    841 - 910
TPGQRGSPGIPGVKGQRGTPGAKGEQGDKGNPGPSEISHVIGDKGEPGLKGFAGNPGEKGNRGVPGMPGL    911 - 980
KGLKGLPGPAGPPGPRGDLGSTGNPGEPGLRGIPGSMGNMGMPGSKGKRGTLGFPGRAGRPGLPGIHGLQ    981 - 1050
GDKGEPGYSEGTRPGPPGPTGDPGLPGDMGKKGEMGQPGPPGHLGPAGPEGAPGSPGSPGLPGKPGPHGD   1051 - 1120
LGFKGIKGLLGPPGIRGPPGLPGFPGSPGPMGIRGDQGRDGIPGPAGEKGETGLLRAPPGPRGNPGAQGA   1121 - 1190
KGDRGAPGFPGLPGRKGAMGDAGPRGPTGIEGFPGPPGLPGAIIPGQTGNRGPPGSRGSPGAPGPPGPPG   1191 - 1260
SHVIGIKGDKGSMGHPGPKGPPGTAGDMGPPGRLGAPGTPGLPGPRGDPGFQGFPGVKGEKGNPGFLGSI   1261 - 1330
GPPGPIGPKGPPGVRGDPGTLKIISLPGSPGPPGTPGEPGMQGEPGPPGPPGNLGPCGPRGKPGKDGKPG   1331 - 1400
TPGPAGEKGNKGSKGEPGPAGSDGLPGLKGKRGDSGSPATWTTRGFVFTRHSQTTAIPSCPEGTVPLYSG   1401 - 1470
FSFLFVQGNQRAHGQDLGTLGSCLQRFTTMPFLFCNVNDVCNFASRNDYSYWLSTPALMPMNMAPITGRA   1471 - 1540
LEPYISRCTVCEGPAIAIAVHSQTTDIPPCPHGWISLWKGFSFIMFTSAGSEGTGQALASPGSCLEEFRA   1541 - 1610
SPFLECHGRGTCNYYSNSYSFWLASLNPERMFRKPIPSTVKAGELEKIISRCQVCMKKRH             1611 - 1670
//

Text Mined References (120)

PMID Year Title
26194984 2015 Novel COL4A3 gene mutations in a consanguineous family with autosomal recessive Alport syndrome.
26138234 2015 Co-Inheritance of Functional Podocin Variants with Heterozygous Collagen IV Mutations Predisposes to Renal Failure.
25596306 2014 COL4A3 mutations cause focal segmental glomerulosclerosis.
25575550 2015 Evidence of digenic inheritance in Alport syndrome.
25514610 2014 Frequency of COL4A3/COL4A4 mutations amongst families segregating glomerular microscopic hematuria and evidence for activation of the unfolded protein response. Focal and segmental glomerulosclerosis is a frequent development during ageing.
25450602 2015 A new mutation in the COL4A3 gene responsible for autosomal dominant Alport syndrome, which only generates hearing loss in some carriers.
25381091 2014 Whole exome sequencing reveals novel COL4A3 and COL4A4 mutations and resolves diagnosis in Chinese families with kidney disease.
25307543 2015 Collagen type IV-related nephropathies in Portugal: pathogenic COL4A3 and COL4A4 mutations and clinical characterization of 25 families.
25229338 2014 Rare hereditary COL4A3/COL4A4 variants may be mistaken for familial focal segmental glomerulosclerosis.
25083577 2014 Polymorphism analysis of COL4A3 and COL4A4 genes in Greek patients with keratoconus.
More...