Property Summary

NCBI Gene PubMed Count 30
PubMed Score 65.02
PubTator Score 34.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
active Crohn's disease -1.497 6.6e-03
cutaneous lupus erythematosus 1.500 2.1e-02
interstitial cystitis 2.200 6.7e-03
osteosarcoma -1.221 4.4e-05
psoriasis 2.800 1.3e-60
tuberculosis -1.300 5.4e-04
ulcerative colitis -1.400 4.0e-05

Gene RIF (17)

AA Sequence

MLALEAAQLDGPHFSCLYPDGVFYDLDSCKHSSYPDSEGAPDSLWDWTVAPPVPATPYEAFDPAAAAFSH      1 - 70
PQAAQLCYEPPTYSPAGNLELAPSLEAPGPGLPAYPTENFASQTLVPPAYAPYPSPVLSEEEDLPLDSPA     71 - 140
LEVSDSESDEALVAGPEGKGSEAGTRKKLRLYQFLLGLLTRGDMRECVWWVEPGAGVFQFSSKHKELLAR    141 - 210
RWGQQKGNRKRMTYQKLARALRNYAKTGEIRKVKRKLTYQFDSALLPAVRRA                      211 - 262
//

Text Mined References (32)

PMID Year Title