Property Summary

NCBI Gene PubMed Count 29
Grant Count 58
R01 Count 42
Funding $7,128,103.11
PubMed Score 143.79
PubTator Score 75.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 3.200 0.000
osteosarcoma -1.221 0.000
atypical teratoid / rhabdoid tumor 1.500 0.029
sonic hedgehog group medulloblastoma 2.700 0.013
medulloblastoma, large-cell 2.300 0.007
lung cancer 3.100 0.002

Synonym

Accession Q01851 Q14986 Q15318 Q5T227
Symbols BRN3A
RDC-1
Oct-T1
brn-3A

Gene

Gene RIF (13)

PMID Text
23666755 Brn3a cooperates with activated RAS/RAF signalling by reducing oncogene-induced senescence in melanocytic tumourigenesis.
22930747 Data indicate that median methylation levels of BCAN, HOXD1, KCTD8, KLF11, NXPH1, POU4F1, SIM1, and TCF7L1 were >/=30% higher than in normal samples, representing potential biomarkers for tumor diagnosis.
22064348 PoU4F1 is highly expressed in t(8;21) samples, with AML/ETO appearning to promote some BRN3A expression
21928122 BRN3A possesses anti-apoptotic property, and considering the above results, it may be regarded as the key component in promoting tumorigenic growth in the uterine cervical cells.
20376082 Dysregulation of POU4F1 is associated with t(8;21) acute myeloid leukemia.
20348952 Ewing sarcoma induce expression of neuronal markers such as BRN3A showing that the function of those same markers may be restricted or controlled in an sarcoma-dependent manner.
16276351 Upregulation of Brn-3a is associated with prostate cancer
16247485 Brn-3a has a role in differential regulation of different human papilloma virus variants
15272315 Hsp27 expression and cell survival are regulated by the POU transcription factor Brn3a
15021903 oncogenic rearrangement of EWS to produce EWS/Fli-1 may enhance the antiapoptotic effect of Brn-3a and inhibit its ability to promote neuronal differentiation.
More...

AA Sequence

MMSMNSKQPHFAMHPTLPEHKYPSLHSSSEAIRRACLPTPPLQSNLFASLDETLLARAEALAAVDIAVSQ      1 - 70
GKSHPFKPDATYHTMNSVPCTSTSTVPLAHHHHHHHHHQALEPGDLLDHISSPSLALMAGAGGAGAAAGG     71 - 140
GGAHDGPGGGGGPGGGGGPGGGPGGGGGGGPGGGGGGPGGGLLGGSAHPHPHMHSLGHLSHPAAAAAMNM    141 - 210
PSGLPHPGLVAAAAHHGAAAAAAAAAAGQVAAASAAAAVVGAAGLASICDSDTDPRELEAFAERFKQRRI    211 - 280
KLGVTQADVGSALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEAEGAQREKMNKPELF    281 - 350
NGGEKKRKRTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSATY     351 - 419
//

Text Mined References (30)

PMID Year Title
23805044 2013 RIT2, a neuron-specific small guanosine triphosphatase, is expressed in retinal neuronal cells and its promoter is modulated by the POU4 transcription factors.
23666755 2013 The neural crest transcription factor Brn3a is expressed in melanoma and required for cell cycle progression and survival.
22930747 2012 Genome-wide methylation screen in low-grade breast cancer identifies novel epigenetically altered genes as potential biomarkers for tumor diagnosis.
22064348 2012 AML1/ETO and POU4F1 synergy drives B-lymphoid gene expression typical of t(8;21) acute myeloid leukemia.
21928122 2011 Molecular analysis of oncogenicity of the transcription factor, BRN3A, in cervical cancer cells.
21116278 2011 Genome-wide association with MRI atrophy measures as a quantitative trait locus for Alzheimer's disease.
20376082 2010 POU4F1 is associated with t(8;21) acute myeloid leukemia and contributes directly to its unique transcriptional signature.
20348952 2010 EWS/ETS proteins promote expression and regulate function of the homeodomain transcription factor BRN3A.
17239249 2007 POU-domain factor Brn3a regulates both distinct and common programs of gene expression in the spinal and trigeminal sensory ganglia.
16276351 2006 Brn-3a neuronal transcription factor functional expression in human prostate cancer.
More...