Property Summary

NCBI Gene PubMed Count 30
PubMed Score 154.84
PubTator Score 75.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.500 2.9e-02
lung cancer 2.400 2.0e-02
malignant mesothelioma 3.200 7.8e-07
medulloblastoma 2.100 1.6e-02
medulloblastoma, large-cell 2.300 7.2e-03
osteosarcoma -1.221 3.6e-04

Gene RIF (14)

AA Sequence

MMSMNSKQPHFAMHPTLPEHKYPSLHSSSEAIRRACLPTPPLQSNLFASLDETLLARAEALAAVDIAVSQ      1 - 70
GKSHPFKPDATYHTMNSVPCTSTSTVPLAHHHHHHHHHQALEPGDLLDHISSPSLALMAGAGGAGAAAGG     71 - 140
GGAHDGPGGGGGPGGGGGPGGGPGGGGGGGPGGGGGGPGGGLLGGSAHPHPHMHSLGHLSHPAAAAAMNM    141 - 210
PSGLPHPGLVAAAAHHGAAAAAAAAAAGQVAAASAAAAVVGAAGLASICDSDTDPRELEAFAERFKQRRI    211 - 280
KLGVTQADVGSALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEAEGAQREKMNKPELF    281 - 350
NGGEKKRKRTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSATY     351 - 419
//

Text Mined References (31)

PMID Year Title