Property Summary

NCBI Gene PubMed Count 222
PubMed Score 1141.58
PubTator Score 476.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma 1.300 3.5e-02
dermatomyositis 1.200 9.0e-04
group 3 medulloblastoma 1.700 8.8e-04
interstitial lung disease 1.100 2.8e-03
medulloblastoma, large-cell 1.200 5.1e-04
oligodendroglioma 1.300 3.5e-02
osteosarcoma 1.123 5.1e-05
ovarian cancer -2.300 1.6e-14
psoriasis 1.900 8.2e-05

Gene RIF (168)

AA Sequence

MASTDYSTYSQAAAQQGYSAYTAQPTQGYAQTTQAYGQQSYGTYGQPTDVSYTQAQTTATYGQTAYATSY      1 - 70
GQPPTGYTTPTAPQAYSQPVQGYGTGAYDTTTATVTTTQASYAAQSAYGTQPAYPAYGQQPAATAPTRPQ     71 - 140
DGNKPTETSQPQSSTGGYNQPSLGYGQSNYSYPQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQ    141 - 210
QNTYGQPSSYGQQSSYGQQSSYGQQPPTSYPPQTGSYSQAPSQYSQQSSSYGQQSSFRQDHPSSMGVYGQ    211 - 280
ESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGSAGERGGFNKPGGPMDEGPDLDLGP    281 - 350
PVDPDEDSDNSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDP    351 - 420
PTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGPGGPMGRMGGR    421 - 490
GGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQNFAWRTECNQCKAPKPEGFLPPPFPPPG    491 - 560
GDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFRGGRGMDRGGFGGGRRGGPGGPPGPLMEQMG    561 - 630
GRRGGRGGPGKMDKGEHRQERRDRPY                                                631 - 656
//

Text Mined References (233)

PMID Year Title