Property Summary

NCBI Gene PubMed Count 195
Grant Count 202
R01 Count 93
Funding $30,665,007.89
PubMed Score 1055.24
PubTator Score 476.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
interstitial lung disease 1.100 0.003
astrocytoma 1.500 0.008
oligodendroglioma 1.300 0.035
psoriasis 1.900 0.000
osteosarcoma 3.146 0.000
group 3 medulloblastoma 1.700 0.001
medulloblastoma, large-cell 1.200 0.001
ovarian cancer -2.300 0.000
dermatomyositis 1.200 0.001

Synonym

Accession Q01844 B0QYK1 Q5THL0 Q92635 Q96FE8 Q96MN4 Q96MX4 Q9BWA2
Symbols EWS
EWS-FLI1
bK984G1.4

Gene

PDB

2CPE  

Gene RIF (142)

PMID Text
26690869 prevalence of the FUS-ERG gene fusion in a large cohort of pathologically and molecularly well characterized small blue round cell tumors, lacking other known gene rearrangements
26573619 FUS and EWS target genes involved in pathways at the RNA regulatory level
26523541 Case Reports: 2 girls with primary renal myoepithelial carcinomas with a novel EWSR1-KLF15 fusion.
26336820 Identify SP1 and PI3K/AKT signaling as modulators of EWS/FLI1 gene expression in tumor cell lines.
25930744 3'-UTR poly(T/U) repeat of EWSR1 is altered in microsatellite unstable colorectal cancer.
25914746 The paper investigates the presence of EWS/FLI-1 fusion in clinically diagnosed sarcoma belonging to different non-Ewing connective tissue tumors.
25851709 study investigated EWSR1 status in ovarian hemangiomas; all cases were negative for EWSR1 rearrangement; 2 cases demonstrated additional intact copies of EWSR1 indicating aneusomy 22 or structural abnormality of chromosome 22 resulting in apparent duplication of the EWSR1 gene region
25751255 Results show that RNA-binding protein EWS binds and regulates CCDC6 expression at RNA and protein levels.
25737553 These experiments establish systemic alternative splicing as an oncogenic process modulated by EWS-FLI1.
25712098 Data suggest that aberrant cell cycle activation in Ewing sarcoma is due to the de-repression of transcription factor E2F targets of transcriptional induction and physical recruitment of E2F3 by fusion protein EWS-FLI1 replacing E2F4 on their promoters.
More...

AA Sequence

MASTDYSTYSQAAAQQGYSAYTAQPTQGYAQTTQAYGQQSYGTYGQPTDVSYTQAQTTATYGQTAYATSY      1 - 70
GQPPTGYTTPTAPQAYSQPVQGYGTGAYDTTTATVTTTQASYAAQSAYGTQPAYPAYGQQPAATAPTRPQ     71 - 140
DGNKPTETSQPQSSTGGYNQPSLGYGQSNYSYPQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQ    141 - 210
QNTYGQPSSYGQQSSYGQQSSYGQQPPTSYPPQTGSYSQAPSQYSQQSSSYGQQSSFRQDHPSSMGVYGQ    211 - 280
ESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGSAGERGGFNKPGGPMDEGPDLDLGP    281 - 350
PVDPDEDSDNSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDP    351 - 420
PTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGPGGPMGRMGGR    421 - 490
GGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQNFAWRTECNQCKAPKPEGFLPPPFPPPG    491 - 560
GDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFRGGRGMDRGGFGGGRRGGPGGPPGPLMEQMG    561 - 630
GRRGGRGGPGKMDKGEHRQERRDRPY                                                631 - 656
//

Text Mined References (206)

PMID Year Title
26690869 2016 Ewing sarcoma with ERG gene rearrangements: A molecular study focusing on the prevalence of FUS-ERG and common pitfalls in detecting EWSR1-ERG fusions by FISH.
26573619 2015 EWS and FUS bind a subset of transcribed genes encoding proteins enriched in RNA regulatory functions.
26523541 2016 Expanding the Spectrum of Renal Tumors in Children: Primary Renal Myoepithelial Carcinomas With a Novel EWSR1-KLF15 Fusion.
26336820 2015 PI3K/AKT signaling modulates transcriptional expression of EWS/FLI1 through specificity protein 1.
25930744 2015 3'-UTR poly(T/U) repeat of EWSR1 is altered in microsatellite unstable colorectal cancer with nearly perfect sensitivity.
25914746 Detection of EWS/FLI-1 fusion in non-Ewing soft tissue tumors.
25851709 2015 Ovarian Hemangiomas Do Not Harbor EWSR1 Rearrangements: Clinicopathologic Characterization of 10 Cases.
25751255 2015 The cell cycle regulator CCDC6 is a key target of RNA-binding protein EWS.
25737553 2015 Oncogenic fusion protein EWS-FLI1 is a network hub that regulates alternative splicing.
25712098 2015 EWS-FLI1 employs an E2F switch to drive target gene expression.
More...