Property Summary

NCBI Gene PubMed Count 302
Grant Count 88
R01 Count 63
Funding $7,674,811.38
PubMed Score 151.00
PubTator Score 399.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.400 0.000

Synonym

Accession Q01831 B4DIP3 E9PB96 E9PH69 Q53GT7 Q96AX0
Symbols XP3
RAD4
XPCC
p125

Gene

XPC

PDB

2A4J   2GGM   2OBH   2RVB  

Gene RIF (295)

PMID Text
27468562 No association between XPC polymorphisms and grades/stages of tumors, but report significant association between XPC PAT and reduction of prostate cancer risk in this group of patients.
26811994 A novel role for the XPC protein in regulating APE1 and OGG1 expression and activity: XPC protein interacts physically with APE1 but not with OGG1.XPC is required for OGG1 activity.
26604426 XPC gene Lys939Gln polymorphism is significantly associated with increased risk of mitral chordae tendineae rupture.
26521083 XPC's function in DNA quality surveillance preventing sunlight-induced skin cancer is discussed. [review]
26384665 A tripartite lesion verification mechanism involving XPC, TFIIH, and XPA is necessary for efficient nucleotide excision repair.
26278556 Missense mutations in the XPC gene may allow partial functionality that could explain this unusual late onset XP. Atypical clinical presentation of XPC could be misdiagnosed when genetic aberrations allow partial DNA repair capacity.
26278177 Structural insight into the mechanism of TFIIH recognition by the acidic string of the nucleotide excision repair factor XPC has been uncovered.
26263968 the release of NER components such as DNA damage binding protein 2 (DDB2) and Xeroderma Pigmentosum complementation group C protein (XPC) following oxidative stress might putatively involve their apoptotic role rather than DNA repair function.
26227012 the present study demonstrates a novel mutation in the XPC gene that may be affecting mRNA synthesis with milder phenotypes.
26214629 Review/Meta-analysis: XPC polymorphisms were not risk factors for the development of colorectal cancer.
More...

AA Sequence

MARKRAAGGEPRGRELRSQKSKAKSKARREEEEEDAFEDEKPPKKSLLSKVSQGKRKRGCSHPGGSADGP      1 - 70
AKKKVAKVTVKSENLKVIKDEALSDGDDLRDFPSDLKKAHHLKRGATMNEDSNEEEEESENDWEEVEELS     71 - 140
EPVLGDVRESTAFSRSLLPVKPVEIEIETPEQAKTRERSEKIKLEFETYLRRAMKRFNKGVHEDTHKVHL    141 - 210
LCLLANGFYRNNICSQPDLHAIGLSIIPARFTRVLPRDVDTYYLSNLVKWFIGTFTVNAELSASEQDNLQ    211 - 280
TTLERRFAIYSARDDEELVHIFLLILRALQLLTRLVLSLQPIPLKSATAKGKKPSKERLTADPGGSSETS    281 - 350
SQVLENHTKPKTSKGTKQEETFAKGTCRPSAKGKRNKGGRKKRSKPSSSEEDEGPGDKQEKATQRRPHGR    351 - 420
ERRVASRVSYKEESGSDEAGSGSDFELSSGEASDPSDEDSEPGPPKQRKAPAPQRTKAGSKSASRTHRGS    421 - 490
HRKDPSLPAASSSSSSSKRGKKMCSDGEKAEKRSIAGIDQWLEVFCEQEEKWVCVDCVHGVVGQPLTCYK    491 - 560
YATKPMTYVVGIDSDGWVRDVTQRYDPVWMTVTRKCRVDAEWWAETLRPYQSPFMDREKKEDLEFQAKHM    561 - 630
DQPLPTAIGLYKNHPLYALKRHLLKYEAIYPETAAILGYCRGEAVYSRDCVHTLHSRDTWLKKARVVRLG    631 - 700
EVPYKMVKGFSNRARKARLAEPQLREENDLGLFGYWQTEEYQPPVAVDGKVPRNEFGNVYLFLPSMMPIG    701 - 770
CVQLNLPNLHRVARKLDIDCVQAITGFDFHGGYSHPVTDGYIVCEEFKDVLLTAWENEQAVIERKEKEKK    771 - 840
EKRALGNWKLLAKGLLIRERLKRRYGPKSEAAAPHTDAGGGLSSDEEEGTSSQAEAARILAASWPQNRED    841 - 910
EEKQKLKGGPKKTKREKKAAASHLFPFEQL                                            911 - 940
//

Text Mined References (322)

PMID Year Title
27468562 2016 Association of XPC Gene Polymorphisms with Prostate Cancer Risk.
26811994 XPC deficiency is related to APE1 and OGG1 expression and function.
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
26604426 2015 DNA Repair Gene Polymorphism and the Risk of Mitral Chordae Tendineae Rupture.
26521083 2016 Xeroderma pigmentosum group C sensor: unprecedented recognition strategy and tight spatiotemporal regulation.
26384665 2015 Tripartite DNA Lesion Recognition and Verification by XPC, TFIIH, and XPA in Nucleotide Excision Repair.
26278556 2015 Atypical Clinical Presentation of Xeroderma Pigmentosum in a Patient Harboring a Novel Missense Mutation in the XPC Gene: The Importance of Clinical Suspicion.
26278177 2015 Structural Insight into the Mechanism of TFIIH Recognition by the Acidic String of the Nucleotide Excision Repair Factor XPC.
26263968 2015 Combination of A? Secretion and Oxidative Stress in an Alzheimer-Like Cell Line Leads to the Over-Expression of the Nucleotide Excision Repair Proteins DDB2 and XPC.
26227012 2015 Novel mutation in the XPC gene: a case report of a patient with xeroderma pigmentosum.
More...