Property Summary

NCBI Gene PubMed Count 50
PubMed Score 74.74
PubTator Score 22.40

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q01813 B3KS15 Q5VSR7 Q5VSR8 ATP-PFK
Symbols PFKF
PFK-C
PFK-P
ATP-PFK

Gene

PDB

4RH3   4U1R   4WL0   4XYJ   4XYK   4XZ2  

Gene RIF (16)

PMID Text
26205495 The crystallized PFKP is permanently activated by a deletion of the 22 C-terminal residues.
24331211 Anti-human protein S antibody induces tissue factor expression through a direct interaction with PFKP and ERK1/2 activation in coronary artery endothelial cells.
23389994 expression of TARDBP is significantly elevated in HCC and it regulates the expression of PFKP, the rate-limiting enzyme for glycolysis, through negative regulation of microRNA 520s (miR-520s).
23166591 Expression of HIV-1 Tat upregulates the abundance of phosphofructokinase (PFKP; platelet) in the nucleoli of Jurkat T-cells
22174317 Expression of HIV-1 Tat upregulates the abundance of phosphofructokinase (PFKP; platelet) in the nucleoli of Jurkat T-cells
21586797 KLF4 plays a role in maintenance of high glycolytic metabolism by transcriptional activation of the PFKP gene in breast cancer cells.
20712903 Observational study of gene-disease association. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18682847 PFKP polymorphisms play no apparent role in the development of common forms of obesity in the Danish population.
More...

AA Sequence

MDADDSRAPKGSLRKFLEHLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFIYEGYQGMVDG      1 - 70
GSNIAEADWESVSSILQVGGTIIGSARCQAFRTREGRLKAACNLLQRGITNLCVIGGDGSLTGANLFRKE     71 - 140
WSGLLEELARNGQIDKEAVQKYAYLNVVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQR    141 - 210
TFVLEVMGRHCGYLALVSALACGADWVFLPESPPEEGWEEQMCVKLSENRARKKRLNIIIVAEGAIDTQN    211 - 280
KPITSEKIKELVVTQLGYDTRVTILGHVQRGGTPSAFDRILASRMGVEAVIALLEATPDTPACVVSLNGN    281 - 350
HAVRLPLMECVQMTQDVQKAMDERRFQDAVRLRGRSFAGNLNTYKRLAIKLPDDQIPKTNCNVAVINVGA    351 - 420
PAAGMNAAVRSAVRVGIADGHRMLAIYDGFDGFAKGQIKEIGWTDVGGWTGQGGSILGTKRVLPGKYLEE    421 - 490
IATQMRTHSINALLIIGGFEAYLGLLELSAAREKHEEFCVPMVMVPATVSNNVPGSDFSIGADTALNTIT    491 - 560
DTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGADAAYIFEEPFDIRDLQSNVEHLTEKMKTTI    561 - 630
QRGLVLRNESCSENYTTDFIYQLYSEEGKGVFDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMEWITAK    631 - 700
LKEARGRGKKFTTDDSICVLGISKRNVIFQPVAELKKQTDFEHRIPKEQWWLKLRPLMKILAKYKASYDV    701 - 770
SDSGQLEHVQPWSV                                                            771 - 784
//

Text Mined References (60)

PMID Year Title
27058317 2016 Metabolic reprogramming during neuronal differentiation.
27049827 2016 The platelet isoform of phosphofructokinase contributes to metabolic reprogramming and maintains cell proliferation in clear cell renal cell carcinoma.
26980488 2016 Genetic alteration in phosphofructokinase family promotes growth of muscle-invasive bladder cancer.
26458310 2015 Identification of lung cancer oncogenes based on the mRNA expression and single nucleotide polymorphism profile data.
26205495 2015 Crystal structure of human platelet phosphofructokinase-1 locked in an activated conformation.
25985179 2015 Structures of human phosphofructokinase-1 and atomic basis of cancer-associated mutations.
25932951 2015 Comprehensive analysis of glycolytic enzymes as therapeutic targets in the treatment of glioblastoma.
25859558 2015 Analysis and interpretation of transcriptomic data obtained from extended Warburg effect genes in patients with clear cell renal cell carcinoma.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
More...