Property Summary

NCBI Gene PubMed Count 47
Grant Count 70
R01 Count 56
Funding $9,074,062.06
PubMed Score 265.26
PubTator Score 396.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.477 0.000
group 3 medulloblastoma 1.400 0.002
ovarian cancer 2.000 0.000

Synonym

Accession Q01780 B1AKQ0 B1AKQ1 Q15158
Symbols p2
p3
p4
RRP6
PMSCL
Rrp6p
PM-Scl
PMSCL2
PM/Scl-100

Gene

PDB

2CPR   3SAF   3SAG   3SAH  

Gene RIF (14)

PMID Text
26857222 EXOSC10 can be modified by SUMOylation and identifies a physiological stress where this regulation is prevalent both in vitro and in vivo.
26687677 Results show that DGCR8 forms an alternative complex with the RRP6-containing form of the exosome, acts as an adaptor to recruit the exosome to target structured RNAs, and the DGCR8/hRRP6 complex controls the stability of human telomerase RNA.
26612606 Rrp6: Integrated roles in nuclear RNA metabolism and transcription termination
25010285 Interaction of HIV-1 Gag with exosome component 10 (EXOSC10) is identified in a series of six affinity purification/mass spectrometry screens
22980978 Microprocessor orchestrates the recruitment of termination factors Setx and Xrn2, and the 3'-5' exoribonuclease, Rrp6, to initiate RNAPII pausing and premature termination at the HIV-1 promoter through cleavage of the stem-loop RNA, TAR.
22261302 Systemic sclerosis patients with anti-PM-Scl antibody are younger and significantly more often have limited cutaneous involvement, skeletal muscle disease, pulmonary fibrosis and calcinosis.
21705430 Saccharomyces cerevisiae Rrp6, and determined the X-ray structure of a human construct containing the exoribonuclease and HRDC domains that retains catalytic activity
19220911 Anti-PM/Scl antibodies are common in distinct SSc subsets and are associated with several clinical symptoms
19103309 autoantibodies specific to this antigen also are found in systemic sclerosis
18854154 Knockdown of exosome component 10 (EXOSC10) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
More...

AA Sequence

MAPPSTREPRVLSATSATKSDGEMVLPGFPDADSFVKFALGSVVAVTKASGGLPQFGDEYDFYRSFPGFQ      1 - 70
AFCETQGDRLLQCMSRVMQYHGCRSNIKDRSKVTELEDKFDLLVDANDVILERVGILLDEASGVNKNQQP     71 - 140
VLPAGLQVPKTVVSSWNRKAAEYGKKAKSETFRLLHAKNIIRPQLKFREKIDNSNTPFLPKIFIKPNAQK    141 - 210
PLPQALSKERRERPQDRPEDLDVPPALADFIHQQRTQQVEQDMFAHPYQYELNHFTPADAVLQKPQPQLY    211 - 280
RPIEETPCHFISSLDELVELNEKLLNCQEFAVDLEHHSYRSFLGLTCLMQISTRTEDFIIDTLELRSDMY    281 - 350
ILNESLTDPAIVKVFHGADSDIEWLQKDFGLYVVNMFDTHQAARLLNLGRHSLDHLLKLYCNVDSNKQYQ    351 - 420
LADWRIRPLPEEMLSYARDDTHYLLYIYDKMRLEMWERGNGQPVQLQVVWQRSRDICLKKFIKPIFTDES    421 - 490
YLELYRKQKKHLNTQQLTAFQLLFAWRDKTARREDESYGYVLPNHMMLKIAEELPKEPQGIIACCNPVPP    491 - 560
LVRQQINEMHLLIQQAREMPLLKSEVAAGVKKSGPLPSAERLENVLFGPHDCSHAPPDGYPIIPTSGSVP    561 - 630
VQKQASLFPDEKEDNLLGTTCLIATAVITLFNEPSAEDSKKGPLTVAQKKAQNIMESFENPFRMFLPSLG    631 - 700
HRAPVSQAAKFDPSTKIYEISNRWKLAQVQVQKDSKEAVKKKAAEQTAAREQAKEACKAAAEQAISVRQQ    701 - 770
VVLENAAKKRERATSDPRTTEQKQEKKRLKISKKPKDPEPPEKEFTPYDYSQSDFKAFAGNSKSKVSSQF    771 - 840
DPNKQTPSGKKCIAAKKIKQSVGNKSMSFPTGKSDRGFRYNWPQR                             841 - 885
//

Publication (53)

PMID Year Title
26857222 2016 Cooling-induced SUMOylation of EXOSC10 down-regulates ribosome biogenesis.
26687677 2015 DGCR8 Acts as an Adaptor for the Exosome Complex to Degrade Double-Stranded Structured RNAs.
26612606 Rrp6: Integrated roles in nuclear RNA metabolism and transcription termination.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
23756462 2013 Exonuclease hDIS3L2 specifies an exosome-independent 3'-5' degradation pathway of human cytoplasmic mRNA.
23439679 2013 Both endonucleolytic and exonucleolytic cleavage mediate ITS1 removal during human ribosomal RNA processing.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...