Property Summary

NCBI Gene PubMed Count 48
PubMed Score 279.06
PubTator Score 396.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.400 1.9e-03
osteosarcoma -1.477 3.8e-04
ovarian cancer 2.000 9.7e-09

Gene RIF (14)

AA Sequence

MAPPSTREPRVLSATSATKSDGEMVLPGFPDADSFVKFALGSVVAVTKASGGLPQFGDEYDFYRSFPGFQ      1 - 70
AFCETQGDRLLQCMSRVMQYHGCRSNIKDRSKVTELEDKFDLLVDANDVILERVGILLDEASGVNKNQQP     71 - 140
VLPAGLQVPKTVVSSWNRKAAEYGKKAKSETFRLLHAKNIIRPQLKFREKIDNSNTPFLPKIFIKPNAQK    141 - 210
PLPQALSKERRERPQDRPEDLDVPPALADFIHQQRTQQVEQDMFAHPYQYELNHFTPADAVLQKPQPQLY    211 - 280
RPIEETPCHFISSLDELVELNEKLLNCQEFAVDLEHHSYRSFLGLTCLMQISTRTEDFIIDTLELRSDMY    281 - 350
ILNESLTDPAIVKVFHGADSDIEWLQKDFGLYVVNMFDTHQAARLLNLGRHSLDHLLKLYCNVDSNKQYQ    351 - 420
LADWRIRPLPEEMLSYARDDTHYLLYIYDKMRLEMWERGNGQPVQLQVVWQRSRDICLKKFIKPIFTDES    421 - 490
YLELYRKQKKHLNTQQLTAFQLLFAWRDKTARREDESYGYVLPNHMMLKIAEELPKEPQGIIACCNPVPP    491 - 560
LVRQQINEMHLLIQQAREMPLLKSEVAAGVKKSGPLPSAERLENVLFGPHDCSHAPPDGYPIIPTSGSVP    561 - 630
VQKQASLFPDEKEDNLLGTTCLIATAVITLFNEPSAEDSKKGPLTVAQKKAQNIMESFENPFRMFLPSLG    631 - 700
HRAPVSQAAKFDPSTKIYEISNRWKLAQVQVQKDSKEAVKKKAAEQTAAREQAKEACKAAAEQAISVRQQ    701 - 770
VVLENAAKKRERATSDPRTTEQKQEKKRLKISKKPKDPEPPEKEFTPYDYSQSDFKAFAGNSKSKVSSQF    771 - 840
DPNKQTPSGKKCIAAKKIKQSVGNKSMSFPTGKSDRGFRYNWPQR                             841 - 885
//

Text Mined References (55)

PMID Year Title