Property Summary

NCBI Gene PubMed Count 35
PubMed Score 31.77
PubTator Score 52.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 1.02642487321118E-12
non-small cell lung cancer 2798 4.28071660279884E-6
interstitial cystitis 2299 4.09229367638302E-5
ovarian cancer 8492 1.4580160716027E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 2.98378570906532E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 8.71606955366032E-4
non-inflammatory breast cancer 208 0.00100530909356114
adrenocortical carcinoma 1427 0.0111001237775668
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0144034463830573
nephrosclerosis 329 0.016393491337803
chronic rhinosinusitis 512 0.0296092888517509
Disease Target Count Z-score Confidence
Heart disease 279 0.0 1.0
Disease Target Count Z-score Confidence
Kabuki syndrome 29 3.02 1.5

Expression

Synonym

Accession Q01740 A8K248 B7Z3P4 Q5QPT2 Q9UJC2
Symbols

Gene

PANTHER Protein Class (2)

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG

Gene RIF (16)

PMID Text
23147717 data support the role of FMO3 in the N-oxidation of OLA and implicate for the first time the contribution of FMO1 and its functional *6 variant in OLA disposition
21540762 polymorphisms in FMO1 are significant risk factors in the development of nicotine dependence and that the mechanism may involve variation in nicotine pharmacology.
21082301 The results of this study suggested that the alteration of FMO gene expression is a consequence of the pathological environment linked to oxidative stress related to mutated SOD1.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20529763 Observational study of gene-disease association. (HuGE Navigator)
20056567 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19898482 Observational study of gene-disease association. (HuGE Navigator)
19552509 The resulting data showed that N,N-dimethylamphetamine N-oxidation is mainly mediated by FMO1.
19336370 Observational study of gene-disease association. (HuGE Navigator)
17127561 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAKRVAIVGAGVSGLASIKCCLEEGLEPTCFERSDDLGGLWRFTEHVEEGRASLYKSVVSNSCKEMSCYS      1 - 70
DFPFPEDYPNYVPNSQFLEYLKMYANHFDLLKHIQFKTKVCSVTKCSDSAVSGQWEVVTMHEEKQESAIF     71 - 140
DAVMVCTGFLTNPYLPLDSFPGINAFKGQYFHSRQYKHPDIFKDKRVLVIGMGNSGTDIAVEASHLAEKV    141 - 210
FLSTTGGGWVISRIFDSGYPWDMVFMTRFQNMLRNSLPTPIVTWLMERKINNWLNHANYGLIPEDRTQLK    211 - 280
EFVLNDELPGRIITGKVFIRPSIKEVKENSVIFNNTSKEEPIDIIVFATGYTFAFPFLDESVVKVEDGQA    281 - 350
SLYKYIFPAHLQKPTLAIIGLIKPLGSMIPTGETQARWAVRVLKGVNKLPPPSVMIEEINARKENKPSWF    351 - 420
GLCYCKALQSDYITYIDELLTYINAKPNLFSMLLTDPHLALTVFFGPCSPYQFRLTGPGKWEGARNAIMT    421 - 490
QWDRTFKVIKARVVQESPSPFESFLKVFSFLALLVAIFLIFL                                491 - 532
//

Text Mined References (35)

PMID Year Title
23147717 2013 Influence of FMO1 and 3 polymorphisms on serum olanzapine and its N-oxide metabolite in psychiatric patients.
21658281 2011 GWAS for discovery and replication of genetic loci associated with sudden cardiac arrest in patients with coronary artery disease.
21540762 2011 Common polymorphisms in FMO1 are associated with nicotine dependence.
21082301 2011 Flavin-containing monooxygenase mRNA levels are up-regulated in als brain areas in SOD1-mutant mice.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20529763 2010 Evaluation of candidate genes for cholinesterase activity in farmworkers exposed to organophosphorus pesticides: association of single nucleotide polymorphisms in BCHE.
20056567 2010 Childhood brain tumors, residential insecticide exposure, and pesticide metabolism genes.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
19552509 2009 Flavin-containing monooxygenase 1-catalysed N,N-dimethylamphetamine N-oxidation.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
More...