Property Summary

NCBI Gene PubMed Count 38
PubMed Score 33.96
PubTator Score 52.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Gene RIF (18)

AA Sequence

MAKRVAIVGAGVSGLASIKCCLEEGLEPTCFERSDDLGGLWRFTEHVEEGRASLYKSVVSNSCKEMSCYS      1 - 70
DFPFPEDYPNYVPNSQFLEYLKMYANHFDLLKHIQFKTKVCSVTKCSDSAVSGQWEVVTMHEEKQESAIF     71 - 140
DAVMVCTGFLTNPYLPLDSFPGINAFKGQYFHSRQYKHPDIFKDKRVLVIGMGNSGTDIAVEASHLAEKV    141 - 210
FLSTTGGGWVISRIFDSGYPWDMVFMTRFQNMLRNSLPTPIVTWLMERKINNWLNHANYGLIPEDRTQLK    211 - 280
EFVLNDELPGRIITGKVFIRPSIKEVKENSVIFNNTSKEEPIDIIVFATGYTFAFPFLDESVVKVEDGQA    281 - 350
SLYKYIFPAHLQKPTLAIIGLIKPLGSMIPTGETQARWAVRVLKGVNKLPPPSVMIEEINARKENKPSWF    351 - 420
GLCYCKALQSDYITYIDELLTYINAKPNLFSMLLTDPHLALTVFFGPCSPYQFRLTGPGKWEGARNAIMT    421 - 490
QWDRTFKVIKARVVQESPSPFESFLKVFSFLALLVAIFLIFL                                491 - 532
//

Text Mined References (38)

PMID Year Title