Property Summary

Ligand Count 76
NCBI Gene PubMed Count 308
PubMed Score 829.15
PubTator Score 591.83

Knowledge Summary

Patent (29,505)

TINX Plot

  Disease (7)

Expression

  Differential Expression (2)

Disease log2 FC p
inflammatory breast cancer 1.200 3.8e-02
lung adenocarcinoma 1.800 2.6e-07

Gene RIF (300)

AA Sequence

MAVQGSQRRLLGSLNSTPTAIPQLGLAANQTGARCLEVSISDGLFLSLGLVSLVENALVVATIAKNRNLH      1 - 70
SPMYCFICCLALSDLLVSGSNVLETAVILLLEAGALVARAAVLQQLDNVIDVITCSSMLSSLCFLGAIAV     71 - 140
DRYISIFYALRYHSIVTLPRARRAVAAIWVASVVFSTLFIAYYDHVAVLLCLVVFFLAMLVLMAVLYVHM    141 - 210
LARACQHAQGIARLHKRQRPVHQGFGLKGAVTLTILLGIFFLCWGPFFLHLTLIVLCPEHPTCGCIFKNF    211 - 280
NLFLALIICNAIIDPLIYAFHSQELRRTLKEVLTCSW                                     281 - 317
//

Text Mined References (310)

PMID Year Title