Property Summary

NCBI Gene PubMed Count 79
Grant Count 26
R01 Count 13
Funding $1,657,895.31
PubMed Score 165.33
PubTator Score 244.42

Knowledge Summary

Patent (8,967)

Gene RIF (64)

PMID Text
26223677 melanocortin receptors MC2R, MC3R and MC5R are most abundantly expressed in glandular epithelium of the endometrium
26115626 the MC2R gene may contribute to the development of intracerebral hemorrhage.
25860801 MC2R and MC1R signals are consecutively required for the regulation of EPO signal transduction in erythroblast differentiation, and MC5R signal transduction is required to induce enucleation.
25605722 results suggest that Phe(7) in ACTH plays an important role in ligand selectivity and that the third transmembrane domain of MC2R is crucial for ACTH selectivity and potency
25055195 The A allele at rs1941088 in the MC2R gene, which encodes the adrenocorticotropic hormone (corticotropin, ACTH) receptor, is associated with a low cortisol response in critically ill children.
24884994 MC2R overexpression is associated with myelolipomas.
24224542 The patient with familial glucocorticoid deficiency was found to be homozygous for a novel mutation in the melanocortin-2 receptor gene (635insC, I154H).
23231661 The ACTHR gene -2T>C variant may be one important factor that influences stress perception of patients with alopecia areata.
23023242 Significant differences in the gene expression of aldosterone synthase and adrenocorticotropic hormone receptor distinguishes adrenal neoplasms from primary aldosteronism.
22842514 Our observations suggest that MC2R is involved in prostate carcinogenesis and that targeting MC2R signaling may provide a novel avenue in prostate carcinoma treatment.
More...

AA Sequence

MKHIINSYENINNTARNNSDCPRVVLPEEIFFTISIVGVLENLIVLLAVFKNKNLQAPMYFFICSLAISD      1 - 70
MLGSLYKILENILIILRNMGYLKPRGSFETTADDIIDSLFVLSLLGSIFSLSVIAADRYITIFHALRYHS     71 - 140
IVTMRRTVVVLTVIWTFCTGTGITMVIFSHHVPTVITFTSLFPLMLVFILCLYVHMFLLARSHTRKISTL    141 - 210
PRANMKGAITLTILLGVFIFCWAPFVLHVLLMTFCPSNPYCACYMSLFQVNGMLIMCNAVIDPFIYAFRS    211 - 280
PELRDAFKKMIFCSRYW                                                         281 - 297
//

Text Mined References (82)

PMID Year Title
26223677 2015 Expression of melanocortin receptors in human endometrium.
26115626 2015 Association between two promoter polymorphisms (rs1893219 and rs1893220) of MC2R gene and intracerebral hemorrhage in Korean population.
25860801 2015 Melanocortins contribute to sequential differentiation and enucleation of human erythroblasts via melanocortin receptors 1, 2 and 5.
25605722 2015 Third transmembrane domain of the adrenocorticotropic receptor is critical for ligand selectivity and potency.
25055195 2014 A single nucleotide polymorphism in the corticotropin receptor gene is associated with a blunted cortisol response during pediatric critical illness.
24884994 2014 Increased expression of ACTH (MC2R) and androgen (AR) receptors in giant bilateral myelolipomas from patients with congenital adrenal hyperplasia.
24224542 Neonatal hyperpigmentation: diagnosis of familial glucocorticoid deficiency with a novel mutation in the melanocortin-2 receptor gene.
23231661 2013 The -2T/C polymorphism in the adrenocorticotropin receptor gene affects stress perception of patients with alopecia areata.
23023242 2012 Expression of aldosterone synthase and adrenocorticotropic hormone receptor in adrenal incidentalomas from normotensive and hypertensive patients: Distinguishing subclinical or atypical primary aldosteronism from adrenal incidentaloma.
22842514 2012 Expression of melanocortin receptors in human prostate cancer cell lines: MC2R activation by ACTH increases prostate cancer cell proliferation.
More...