Property Summary

Ligand Count 3
NCBI Gene PubMed Count 82
PubMed Score 172.43
PubTator Score 244.42

Knowledge Summary

Patent (8,967)

Expression

  Differential Expression (3)

Disease log2 FC p
adrenocortical carcinoma -2.073 2.3e-02
osteosarcoma 1.043 2.7e-05
ovarian cancer 1.300 1.8e-11

Gene RIF (66)

AA Sequence

MKHIINSYENINNTARNNSDCPRVVLPEEIFFTISIVGVLENLIVLLAVFKNKNLQAPMYFFICSLAISD      1 - 70
MLGSLYKILENILIILRNMGYLKPRGSFETTADDIIDSLFVLSLLGSIFSLSVIAADRYITIFHALRYHS     71 - 140
IVTMRRTVVVLTVIWTFCTGTGITMVIFSHHVPTVITFTSLFPLMLVFILCLYVHMFLLARSHTRKISTL    141 - 210
PRANMKGAITLTILLGVFIFCWAPFVLHVLLMTFCPSNPYCACYMSLFQVNGMLIMCNAVIDPFIYAFRS    211 - 280
PELRDAFKKMIFCSRYW                                                         281 - 297
//

Text Mined References (85)

PMID Year Title