Property Summary

NCBI Gene PubMed Count 32
Grant Count 87
R01 Count 33
Funding $12,823,834.28
PubMed Score 18.62
PubTator Score 111.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 2.300 0.000
osteosarcoma 1.124 0.000

Synonym

Accession Q01664 O60409
Symbols AP-4
bHLHc41

Gene

Gene RIF (17)

PMID Text
25261373 results indicate that AP4 is a central mediator and coordinator of cell cycle progression
24500709 betaTrCP-dependent degradation of TFAP4 is required for the fidelity of mitotic division
24065543 the 16 SNP variants studied in the genes encoding the four units of AP-4 do not have a major role in overall CP, but SNP rs1217401 of AP4B1 is significantly associated with the risk of CP as a sequela of neonatal HIE in the Chinese population.
23949224 Senescence caused by AP4-deficiency was prevented by depletion of p16 and/or p21, demonstrating that these factors mediate senescence caused by AP4 loss.
23752226 Elevated AP4 expression in primary colorectal cancer (CRC) significantly correlated with liver metastasis and poor patient survival. Findings imply AP4 as a new regulator of epithelial-mesenchymal transition that contributes to metastatic processes in CRC
23055200 findings provide evidence that a high expression level of AP-4 serves as a biomarker for poor prognosis for hepatocellular carcinoma
22615908 The expression of AP-4 was silenced by the siRNAs transfection.
22077140 Interaction of TFIID with the HIV-1 LTR, and therefore presumably HIV-1 Tat protein, is primarily dependent on the LTR TATA element and may also be stabilized or regulated by flanking E box motifs and basic helix-loop-helix proteins such as AP-4 and E47
21719561 in serum- or IGF-1-stimulated breast cancer MCF-7 cells, JNK induces SHP1 expression through the binding of AP-4 and RFX-1 transcription factors to the epithelial tissue-specific SHP1 promoter.
21336989 Overexpression of AP-4 is associated with gastric carcinoma.
More...

AA Sequence

MEYFMVPTQKVPSLQHFRKTEKEVIGGLCSLANIPLTPETQRDQERRIRREIANSNERRRMQSINAGFQS      1 - 70
LKTLIPHTDGEKLSKAAILQQTAEYIFSLEQEKTRLLQQNTQLKRFIQELSGSSPKRRRAEDKDEGIGSP     71 - 140
DIWEDEKAEDLRREMIELRQQLDKERSVRMMLEEQVRSLEAHMYPEKLKVIAQQVQLQQQQEQVRLLHQE    141 - 210
KLEREQQQLRTQLLPPPAPTHHPTVIVPAPPPPPSHHINVVTMGPSSVINSVSTSRQNLDTIVQAIQHIE    211 - 280
GTQEKQELEEEQRRAVIVKPVRSCPEAPTSDTASDSEASDSDAMDQSREEPSGDGELP                281 - 338
//

Publication (37)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25261373 2014 AP4 is required for mitogen- and c-MYC-induced cell cycle progression.
24500709 2014 Proteasome-dependent degradation of transcription factor activating enhancer-binding protein 4 (TFAP4) controls mitotic division.
24065543 2013 Genetic association study of adaptor protein complex 4 with cerebral palsy in a Han Chinese population.
23949224 2013 AP4 directly downregulates p16 and p21 to suppress senescence and mediate transformation.
23752226 2013 AP4 is a mediator of epithelial-mesenchymal transition and metastasis in colorectal cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23055200 2013 High expression of AP-4 predicts poor prognosis for hepatocellular carcinoma after curative hepatectomy.
22615908 2012 Down-regulation of AP-4 inhibits proliferation, induces cell cycle arrest and promotes apoptosis in human gastric cancer cells.
21719561 2011 Breast cancer cells proliferation is regulated by tyrosine phosphatase SHP1 through c-jun N-terminal kinase and cooperative induction of RFX-1 and AP-4 transcription factors.
More...