Property Summary

NCBI Gene PubMed Count 34
PubMed Score 19.37
PubTator Score 111.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
malignant mesothelioma 3232 1.3e-07
osteosarcoma 7950 3.8e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Spinocerebellar ataxia type 12 5 4.098 2.0

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 2.300 1.3e-07
osteosarcoma 1.124 3.8e-05

Gene RIF (19)

AA Sequence

MEYFMVPTQKVPSLQHFRKTEKEVIGGLCSLANIPLTPETQRDQERRIRREIANSNERRRMQSINAGFQS      1 - 70
LKTLIPHTDGEKLSKAAILQQTAEYIFSLEQEKTRLLQQNTQLKRFIQELSGSSPKRRRAEDKDEGIGSP     71 - 140
DIWEDEKAEDLRREMIELRQQLDKERSVRMMLEEQVRSLEAHMYPEKLKVIAQQVQLQQQQEQVRLLHQE    141 - 210
KLEREQQQLRTQLLPPPAPTHHPTVIVPAPPPPPSHHINVVTMGPSSVINSVSTSRQNLDTIVQAIQHIE    211 - 280
GTQEKQELEEEQRRAVIVKPVRSCPEAPTSDTASDSEASDSDAMDQSREEPSGDGELP                281 - 338
//

Text Mined References (40)

PMID Year Title