Property Summary

NCBI Gene PubMed Count 26
PubMed Score 313.76
PubTator Score 585.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma -1.300 7.1e-03
atypical teratoid / rhabdoid tumor -1.300 2.8e-03
Breast cancer 2.600 3.7e-02
cystic fibrosis -1.200 1.7e-05
glioblastoma 1.200 2.0e-03
intraductal papillary-mucinous adenoma (... 1.600 1.5e-03
intraductal papillary-mucinous carcinoma... 1.800 1.2e-03
lung cancer 1.200 1.5e-02
malignant mesothelioma -1.100 2.2e-06
medulloblastoma, large-cell 1.200 1.5e-03
Multiple myeloma 1.116 9.4e-03
non primary Sjogren syndrome sicca -1.100 2.1e-02
osteosarcoma -1.435 1.5e-03
ovarian cancer -1.300 4.2e-05
pancreatic cancer 1.100 1.8e-03
pancreatic carcinoma 1.100 1.8e-03
psoriasis 1.900 5.5e-05
sarcoidosis 1.200 5.2e-03
Waldenstrons macroglobulinemia 1.199 4.6e-02

Gene RIF (11)

AA Sequence

MASSSGNDDDLTIPRAAINKMIKETLPNVRVANDARELVVNCCTEFIHLISSEANEICNKSEKKTISPEH      1 - 70
VIQALESLGFGSYISEVKEVLQECKTVALKRRKASSRLENLGIPEEELLRQQQELFAKARQQQAELAQQE     71 - 140
WLQMQQAAQQAQLAAASASASNQAGSSQDEEDDDDI                                      141 - 176
//

Text Mined References (34)

PMID Year Title