Property Summary

NCBI Gene PubMed Count 24
PubMed Score 303.06
PubTator Score 585.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 6.81555864224263E-7
malignant mesothelioma 3163 2.16859698844496E-6
cystic fibrosis 1670 1.68739145869303E-5
ovarian cancer 8492 4.20600296461146E-5
psoriasis 6685 5.5190660389347E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00120034424113436
medulloblastoma, large-cell 6234 0.00148760396265901
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00152161045209632
pancreatic cancer 2300 0.00178469508369224
pancreatic carcinoma 567 0.00178469508369227
glioblastoma 5572 0.00202360373032201
atypical teratoid / rhabdoid tumor 4369 0.00281366539995131
lung cancer 4473 0.00443860541376456
sarcoidosis 368 0.00522151381696735
adult high grade glioma 2148 0.00707374027065682
primary Sjogren syndrome 789 0.00891088598910861
Multiple myeloma 1328 0.00936423753547663
Breast cancer 3099 0.0368004265339736
Waldenstrons macroglobulinemia 765 0.0455120641754024

Expression

  Differential Expression (19)

Disease log2 FC p
pancreatic cancer 1.100 0.002
Waldenstrons macroglobulinemia 1.199 0.046
Multiple myeloma 1.116 0.009
malignant mesothelioma -1.100 0.000
psoriasis 1.900 0.000
osteosarcoma -2.342 0.000
glioblastoma 1.200 0.002
atypical teratoid / rhabdoid tumor -1.300 0.003
medulloblastoma, large-cell 1.200 0.001
intraductal papillary-mucinous adenoma (... 1.600 0.002
intraductal papillary-mucinous carcinoma... 1.800 0.001
lung cancer 1.800 0.004
sarcoidosis 1.200 0.005
Breast cancer 2.600 0.037
cystic fibrosis -1.200 0.000
adult high grade glioma -1.300 0.007
primary Sjogren syndrome 1.200 0.009
pancreatic carcinoma 1.100 0.002
ovarian cancer -1.300 0.000

Synonym

Accession Q01658
Symbols NC2
NC2B
NC2-BETA

Gene

DR1

PDB

1JFI  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly OMA EggNOG Inparanoid
S.cerevisiae EggNOG Inparanoid

Gene RIF (10)

PMID Text
25589657 Knockdown of DR1 resulted in reductions of viral RNA and protein production, demonstrating that DR1 acts as a positive host factor in influenza A virus replication.
20534741 Observational study of gene-disease association. (HuGE Navigator)
20230619 Basal core promoters control the equilibrium between negative cofactor 2 and preinitiation complexes in human cells.
19965767 The physiological functions of human Dr1 include regulation of polymerase III transcription.
19204005 heterodimerization with NC2alpha masks the nuclear localization signal in NC2beta, which prevents nuclear export of the NC2 complex
18838386 ATAC Is a GCN5/PCAF-containing acetylase complex with a novel NC2-like histone fold module that interacts with the TATA-binding protein
18538002 Data show that NC2beta is specifically involved in neuroblastoma pathogenesis and may be considered a new neuroblastoma biomarker.
17584739 the initiator core promoter element antagonizes repression of TATA-directed transcription by negative cofactor NC2
15574413 NC2 controls TBP binding and maintenance on DNA that is largely independent of a canonical TATA sequence
8764062 Interaction of HIV-1 Tat with TBP/TFIID competes with negative cofactor Dr1 interaction with TBP, thereby inhibiting Dr1

AA Sequence

MASSSGNDDDLTIPRAAINKMIKETLPNVRVANDARELVVNCCTEFIHLISSEANEICNKSEKKTISPEH      1 - 70
VIQALESLGFGSYISEVKEVLQECKTVALKRRKASSRLENLGIPEEELLRQQQELFAKARQQQAELAQQE     71 - 140
WLQMQQAAQQAQLAAASASASNQAGSSQDEEDDDDI                                      141 - 176
//

Text Mined References (32)

PMID Year Title
25589657 2015 A host susceptibility gene, DR1, facilitates influenza A virus replication by suppressing host innate immunity and enhancing viral RNA replication.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20534741 2010 Association of CR1, CLU and PICALM with Alzheimer's disease in a cohort of clinically characterized and neuropathologically verified individuals.
20230619 2010 Basal core promoters control the equilibrium between negative cofactor 2 and preinitiation complexes in human cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19965767 2010 Dr1 (NC2) is present at tRNA genes and represses their transcription in human cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...