Property Summary

NCBI Gene PubMed Count 120
PubMed Score 156.12
PubTator Score 214.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Atopic dermatitis 1.600 2.0e-04
Breast cancer 1.100 1.1e-02
breast carcinoma 1.200 6.1e-17
colon cancer 2.100 3.4e-07
cystic fibrosis -1.297 1.1e-05
ductal carcinoma in situ 2.400 1.2e-03
Gaucher disease type 3 1.200 4.8e-02
invasive ductal carcinoma 3.000 2.3e-04
lung adenocarcinoma 1.500 2.1e-10
lung cancer 3.700 1.1e-06
malignant mesothelioma 1.300 1.2e-05
non diabetic and post-ischemic heart fai... -1.100 1.1e-02
non primary Sjogren syndrome sicca 1.200 1.6e-02
non-small cell lung cancer 2.363 1.1e-18
osteosarcoma -1.731 2.7e-02
ovarian cancer 1.400 1.8e-05
Polycystic ovary syndrome -1.138 4.8e-02
psoriasis 1.300 4.4e-06
tuberculosis -3.100 6.5e-06
ulcerative colitis 1.800 1.7e-05

Gene RIF (100)

AA Sequence

MAGAGPKRRALAAPAAEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNITLLNGVAIIVGTIIGSGIFV      1 - 70
TPTGVLKEAGSPGLALVVWAACGVFSIVGALCYAELGTTISKSGGDYAYMLEVYGSLPAFLKLWIELLII     71 - 140
RPSSQYIVALVFATYLLKPLFPTCPVPEEAAKLVACLCVLLLTAVNCYSVKAATRVQDAFAAAKLLALAL    141 - 210
IILLGFVQIGKGDVSNLDPNFSFEGTKLDVGNIVLALYSGLFAYGGWNYLNFVTEEMINPYRNLPLAIII    211 - 280
SLPIVTLVYVLTNLAYFTTLSTEQMLSSEAVAVDFGNYHLGVMSWIIPVFVGLSCFGSVNGSLFTSSRLF    281 - 350
FVGSREGHLPSILSMIHPQLLTPVPSLVFTCVMTLLYAFSKDIFSVINFFSFFNWLCVALAIIGMIWLRH    351 - 420
RKPELERPIKVNLALPVFFILACLFLIAVSFWKTPVECGIGFTIILSGLPVYFFGVWWKNKPKWLLQGIF    421 - 490
STTVLCQKLMQVVPQET                                                         491 - 507
//

Text Mined References (134)

PMID Year Title