Property Summary

NCBI Gene PubMed Count 104
PubMed Score 135.56
PubTator Score 214.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
psoriasis 2.000 0.000
osteosarcoma -1.731 0.027
cystic fibrosis -1.297 0.000
non diabetic and post-ischemic heart fai... -1.100 0.011
Atopic dermatitis 1.600 0.000
tuberculosis -3.100 0.000
non-small cell lung cancer 2.363 0.000
lung cancer 3.900 0.000
colon cancer 2.100 0.000
lung adenocarcinoma 1.500 0.000
non primary Sjogren syndrome sicca 1.200 0.016
inflammatory breast cancer 2.300 0.005
Polycystic Ovary Syndrome -1.138 0.048
breast carcinoma 1.200 0.000
ductal carcinoma in situ 2.400 0.001
invasive ductal carcinoma 3.000 0.000
ulcerative colitis 1.800 0.000
ovarian cancer 1.400 0.000
Gaucher disease type 3 1.200 0.048

Synonym

Accession Q01650 Q8IV97 Q9UBN8 Q9UP15 Q9UQC0
Symbols E16
CD98
LAT1
4F2LC
MPE16
D16S469E

Gene

PANTHER Protein Class (2)

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (85)

PMID Text
26944194 Proliferation of breast cancer cells is dependent on the expression of both LAT1 and AHR.
26621329 exposure to diesel exhaust particle extract induces functional overexpression of the amino acid transporter LAT1/CD98hc in lung cells
26608079 Propose regulation of placental SNAT2/LAT1 ubiquitination by mTORC1 and Nedd4-2.
26437640 CD98 promotes cell spreading and tumorigenicity by triggering integrin clustering and enhancing cell adhesion to the extracellular matrix.
26256001 LAT1 is the transport competent unit of the LAT1/CD98 heterodimeric amino acid transporter.
26237765 LAT1 can serve as a significant prognostic factor to predict a poor outcome and it may therefore play an important role in the aggressiveness of cutaneous melanoma.
26054677 miR-126 plays a pivotal role in GC (gastric cancer) suppressing the process of GC cell, and this function is at least partly taken to implement by miR-126s's post-transcriptional effect on LAT-1.
26050671 LAT1 and LAT2 are present and functional in the syncytiotrophoblast MVM, whereas LAT2 is also expressed in the BM and in the fetal capillary endothelium.
25998567 LAPTM4b recruits LAT1-4F2hc to lysosomes, leading to uptake of leucine into lysosomes.
25979827 shRNA-mediated knockdown of Lat1 results in tumor growth inhibition and points to Lat1 as a potential therapeutic target.
More...

AA Sequence

MAGAGPKRRALAAPAAEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNITLLNGVAIIVGTIIGSGIFV      1 - 70
TPTGVLKEAGSPGLALVVWAACGVFSIVGALCYAELGTTISKSGGDYAYMLEVYGSLPAFLKLWIELLII     71 - 140
RPSSQYIVALVFATYLLKPLFPTCPVPEEAAKLVACLCVLLLTAVNCYSVKAATRVQDAFAAAKLLALAL    141 - 210
IILLGFVQIGKGDVSNLDPNFSFEGTKLDVGNIVLALYSGLFAYGGWNYLNFVTEEMINPYRNLPLAIII    211 - 280
SLPIVTLVYVLTNLAYFTTLSTEQMLSSEAVAVDFGNYHLGVMSWIIPVFVGLSCFGSVNGSLFTSSRLF    281 - 350
FVGSREGHLPSILSMIHPQLLTPVPSLVFTCVMTLLYAFSKDIFSVINFFSFFNWLCVALAIIGMIWLRH    351 - 420
RKPELERPIKVNLALPVFFILACLFLIAVSFWKTPVECGIGFTIILSGLPVYFFGVWWKNKPKWLLQGIF    421 - 490
STTVLCQKLMQVVPQET                                                         491 - 507
//

Publication (118)

PMID Year Title
26944194 2016 Aryl hydrocarbon receptor (AHR) regulation of L-Type Amino Acid Transporter 1 (LAT-1) expression in MCF-7 and MDA-MB-231 breast cancer cells.
26621329 2016 Aryl hydrocarbon receptor-dependent up-regulation of the heterodimeric amino acid transporter LAT1 (SLC7A5)/CD98hc (SLC3A2) by diesel exhaust particle extract in human bronchial epithelial cells.
26608079 2016 Regulation of amino acid transporter trafficking by mTORC1 in primary human trophoblast cells is mediated by the ubiquitin ligase Nedd4-2.
26437640 2015 Basigin-mediated redistribution of CD98 promotes cell spreading and tumorigenicity in hepatocellular carcinoma.
26256001 2015 LAT1 is the transport competent unit of the LAT1/CD98 heterodimeric amino acid transporter.
26237765 2015 Prognostic significance of L-type amino acid transporter 1 (LAT1) expression in cutaneous melanoma.
26054677 2015 MicroRNA-126 inhibits cell proliferation in gastric cancer by targeting LAT-1.
26050671 2015 Expression and functional characterisation of System L amino acid transporters in the human term placenta.
25998567 2015 LAPTM4b recruits the LAT1-4F2hc Leu transporter to lysosomes and promotes mTORC1 activation.
25979827 2015 Reciprocal regulation of amino acid import and epigenetic state through Lat1 and EZH2.
More...