Property Summary

NCBI Gene PubMed Count 186
Grant Count 351
R01 Count 208
Funding $39,540,925.68
PubMed Score 91.70
PubTator Score 1427.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Synonym

Accession Q01638 A8K6B3 B4E0I3 Q53TU7 Q8NEJ3 Q9ULV7 Q9UQ44
Symbols T1
ST2
DER4
ST2L
ST2V
FIT-1
IL33R

Gene

PDB

4KC3  

Gene RIF (148)

PMID Text
26835712 ST2 is associated with advanced and metastatic disease in GC patients and significantly correlates with the duration of the disease.
26679377 The IL-33/ST2 signalling axis may have a protective role in colon carcinogenesis.
26493291 rs1558641 was positively associated with atopic asthma in a Chinese population.
26365875 The activity of IL-33 at its receptor ST2 is terminated by the formation of two disulphide bridges, resulting in conformational change that disrupts the ST2 binding site.
25977120 IL-33 and soluble ST2 values in peritoneal fluid were found to correlate with endometriosis severity. Elevated and correlated peritoneal fluid IL-33 and soluble ST2 levels from endometriosis patients suggested a potential role as biomarkers of disease.
25919009 Serum ST2 levels are affected by the right but not the LV function and show no association with clinical indices of heart failure.
25892854 ST2 may have a role in mortality in HBV-related acute-on-chronic liver failure
25881899 study establishes the first cross-sectional protein expression profile of SAMHD1 in human tissues and provides insight into its cell cycle-dependent phosphorylation and unresponsiveness to multiple proinflammatory cytokines
25798875 Lower baseline ST2 levels independently predict disease remission and baseline detectable IL-33 independently predicts carotid plaque progression in early rheumatoid arthritis patients
25753178 Soluble suppression of tumorigenicity 2 (sST2), but not galactin-3, adds to prognostication in patients with systemic AL amyloidosis independent of NT-proBNP and troponin T.
More...

AA Sequence

MGFWILAILTILMYSTAAKFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQ      1 - 70
LLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYN     71 - 140
WTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSL    141 - 210
FPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGL    211 - 280
ACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPIDHHSIYCIIAVCSVFLMLINVLVIIL    281 - 350
KMFWIEATLLWRDIAKPYKTRNDGKLYDAYVVYPRNYKSSTDGASRVEHFVHQILPDVLENKCGYTLCIY    351 - 420
GRDMLPGEDVVTAVETNIRKSRRHIFILTPQITHNKEFAYEQEVALHCALIQNDAKVILIEMEALSELDM    421 - 490
LQAEALQDSLQHLMKVQGTIKWREDHIANKRSLNSKFWKHVRYQMPVPSKIPRKASSLTPLAAQKQ        491 - 556
//

Publication (189)

PMID Year Title
26835712 2016 High plasma sST2 levels in gastric cancer and their association with metastatic disease.
26679377 2016 An antitumorigenic role for the IL-33 receptor, ST2L, in colon cancer.
26493291 2015 Polymorphisms of RAD50, IL33 and IL1RL1 are associated with atopic asthma in Chinese population.
26365875 2015 Oxidation of the alarmin IL-33 regulates ST2-dependent inflammation.
25977120 2015 Soluble ST2 and IL-33: Potential markers of endometriosis in the Tunisian population.
25919009 2015 NGAL and ST2 levels in ambulatory patients with chronic heart failure. Clinical and echocardiographic correlates.
25892854 2015 Soluble ST2 plasma concentrations predict mortality in HBV-related acute-on-chronic liver failure.
25881899 2015 The potential role of IL-33/ST2 signaling in fibrotic diseases.
25798875 2015 IL-33 and soluble ST2 levels as novel predictors for remission and progression of carotid plaque in early rheumatoid arthritis: A prospective study.
25753178 2015 Soluble suppression of tumorigenicity 2 (sST2), but not galactin-3, adds to prognostication in patients with systemic AL amyloidosis independent of NT-proBNP and troponin T.
More...