Property Summary

NCBI Gene PubMed Count 27
PubMed Score 171.11
PubTator Score 25.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
active Crohn's disease 1.952 2.9e-02
active ulcerative colitis 1.923 7.7e-03
acute quadriplegic myopathy 1.055 8.2e-05
dermatomyositis 2.100 7.6e-04
Down syndrome 1.200 4.4e-02
ependymoma 1.200 8.8e-05
esophageal adenocarcinoma 1.200 2.6e-02
glioblastoma 2.200 7.9e-03
group 4 medulloblastoma -1.300 3.9e-03
interstitial cystitis 1.400 1.3e-04
intraductal papillary-mucinous adenoma (... -2.700 1.3e-04
intraductal papillary-mucinous carcinoma... -2.000 2.5e-02
juvenile dermatomyositis 1.868 1.1e-16
lung cancer -1.600 5.3e-05
lung carcinoma -1.700 1.5e-23
medulloblastoma, large-cell -1.400 1.1e-02
Multiple myeloma 1.460 1.6e-02
ovarian cancer -1.600 3.6e-06
pancreatic cancer 1.300 2.1e-03
pancreatic ductal adenocarcinoma liver m... -1.144 1.2e-02
pituitary cancer -2.200 2.8e-07
Systemic lupus erythematosus 1.100 7.9e-05
tuberculosis 1.200 1.6e-05

Gene RIF (27)

AA Sequence

MNHIVQTFSPVNSGQPPNYEMLKEEQEVAMLGVPHNPAPPMSTVIHIRSETSVPDHVVWSLFNTLFMNTC      1 - 70
CLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGIFMTILLIIIPVLVVQAQR             71 - 132
//

Text Mined References (32)

PMID Year Title