Property Summary

NCBI Gene PubMed Count 23
Grant Count 8
R01 Count 6
Funding $777,190.08
PubMed Score 158.12
PubTator Score 25.98

Knowledge Summary

Patent

No data available

Expression

Gene RIF (39)

PMID Text
26387945 IFITM2 and IFITM3 specifically antagonize the HIV-1 envelope glycoprotein (Env), thereby inhibiting viral infection.
26387945 HIV-1 gp120 interacts with IFITM2
26387945 HIV-1 gp120 interacts with IFITM2
26387945 HIV-1 gp120 interacts with IFITM2
26387945 HIV-1 gp120 interacts with IFITM2
26387945 HIV-1 gp120 interacts with IFITM2
26387945 HIV-1 infectivity is inhibited when IFITM2 is expressed by the virus producing cell (293T cells)
26387945 HIV-1 infectivity is inhibited when IFITM2 is expressed by the virus producing cell (293T cells)
26354436 propose that the IFITM proteins act in a coordinated manner to restrict HCV infection by targeting the endocytosed HCV virion for lysosomal degradation and demonstrate that the actions of the IFITM proteins are indeed virus and cell-type specific
26116899 HIV-1 gp120 interacts with IFITM2
More...

AA Sequence

MNHIVQTFSPVNSGQPPNYEMLKEEQEVAMLGVPHNPAPPMSTVIHIRSETSVPDHVVWSLFNTLFMNTC      1 - 70
CLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGIFMTILLIIIPVLVVQAQR             71 - 132
//

Publication (28)

PMID Year Title
26387945 2015 IFITM Proteins Restrict HIV-1 Infection by Antagonizing the Envelope Glycoprotein.
26354436 2015 The Interferon-induced Transmembrane Proteins, IFITM1, IFITM2, and IFITM3 Inhibit Hepatitis C Virus Entry.
25552713 2015 Human cytomegalovirus exploits interferon-induced transmembrane proteins to facilitate morphogenesis of the virion assembly compartment.
25464829 2014 IFITM proteins incorporated into HIV-1 virions impair viral fusion and spread.
25422070 2014 IFITM proteins are incorporated onto HIV-1 virion particles and negatively imprint their infectivity.
24992036 2014 G3BP1, G3BP2 and CAPRIN1 are required for translation of interferon stimulated mRNAs and are targeted by a dengue virus non-coding RNA.
23720721 2013 IFITM-2 and IFITM-3 but not IFITM-1 restrict Rift Valley fever virus.
23376165 2013 Characteristics of IFITM, the newly identified IFN-inducible anti-HIV-1 family proteins.
23358889 2013 IFITM proteins restrict viral membrane hemifusion.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...