Property Summary

NCBI Gene PubMed Count 72
PubMed Score 151.25
PubTator Score 69.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
active Crohn's disease 1.644 2.3e-02
active ulcerative colitis 1.679 3.5e-03
acute myeloid leukemia -2.000 2.9e-02
acute quadriplegic myopathy 1.048 6.4e-05
dermatomyositis 1.300 1.1e-02
Down syndrome 1.200 2.7e-02
Duchenne muscular dystrophy 1.016 1.2e-06
esophageal adenocarcinoma 1.100 2.3e-02
glioblastoma 2.100 2.6e-02
group 4 medulloblastoma -1.400 1.9e-04
interstitial cystitis 1.100 2.6e-04
intraductal papillary-mucinous adenoma (... -2.200 9.6e-05
intraductal papillary-mucinous carcinoma... -1.500 2.0e-02
juvenile dermatomyositis 2.145 2.8e-18
lung cancer -1.700 3.9e-04
lung carcinoma -1.800 3.9e-25
medulloblastoma, large-cell -1.700 2.8e-03
Multiple Sclerosis 1.600 1.7e-03
non-inflammatory breast cancer 1.200 1.0e-02
ovarian cancer -1.300 2.7e-05
pituitary cancer -2.200 3.7e-06
posterior fossa group A ependymoma 1.200 1.8e-06
Systemic lupus erythematosus 1.200 1.3e-04
tuberculosis 1.400 1.1e-04

Gene RIF (67)

AA Sequence

MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNP      1 - 70
CCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG            71 - 133
//

Text Mined References (78)

PMID Year Title