Property Summary

NCBI Gene PubMed Count 56
PubMed Score 126.00
PubTator Score 69.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Influenza 142
Disease Target Count P-value
lung carcinoma 2844 3.94402862407989E-25
juvenile dermatomyositis 1189 2.79386055247784E-18
ulcerative colitis 2087 1.36588160184406E-8
Duchenne muscular dystrophy 602 1.22519916920532E-6
posterior fossa group A ependymoma 1511 1.7721069439915E-6
ovarian cancer 8492 2.80615286760437E-6
pituitary cancer 1972 3.73185604427712E-6
acute quadriplegic myopathy 1157 6.41195115534937E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 9.64146036329696E-5
tuberculosis 1563 1.12854637647095E-4
systemic lupus erythematosus 172 1.31726720847173E-4
group 4 medulloblastoma 1875 1.94392419930385E-4
interstitial cystitis 2299 2.64308184160001E-4
lung cancer 4473 3.91529502584468E-4
Multiple Sclerosis 498 0.00165881885289703
medulloblastoma, large-cell 6234 0.00281207634939143
non-inflammatory breast cancer 208 0.0100192768369911
dermatomyositis 967 0.0107662492936401
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0203111433304925
active Crohn's disease 918 0.0229954020180732
esophageal adenocarcinoma 737 0.0232677465279006
glioblastoma 5572 0.02578920905604
Down syndrome 548 0.0273620816708315
acute myeloid leukemia 785 0.028957607269512

Expression

Synonym

Accession Q01628 Q53Y76 Q96HK8 Q96J15
Symbols 1-8U
IP15
DSPA2b

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG
Mouse OMA EggNOG
Rat OMA EggNOG
Dog OMA EggNOG
Horse OMA EggNOG

Gene RIF (51)

PMID Text
26387945 IFITM2 and IFITM3 specifically antagonize the HIV-1 envelope glycoprotein (Env), thereby inhibiting viral infection.
26387945 HIV-1 gp120 shedding is induced by IFITM3
26387945 HIV-1 infectivity is inhibited when IFITM3 is expressed by the virus producing cell (293T cells)
26354436 propose that the IFITM proteins act in a coordinated manner to restrict HCV infection by targeting the endocytosed HCV virion for lysosomal degradation and demonstrate that the actions of the IFITM proteins are indeed virus and cell-type specific
26263374 we demonstrate that the E3 ubiquitin ligase NEDD4 ubiquitinates IFITM3 in cells and in vitro.
26116899 HIV-1 gp120 shedding is induced by IFITM3
25942469 Our meta-analysis suggests a significant association between a minor IFITM3 allele (SNP rs12252-C) with severe influenza susceptibility, but not in mild influenza subjects
25784441 A novel association between IFITM3 gene polymorphism and rapid disease progression is reported in an acute HIV-1-infected MSM cohort in China.
25778715 This meta-analysis suggests that IFITM3 rs12252 T>C polymorphism is significantly associated with increased risk of severe influenza but not with the chance of initial virus infection.
25552713 Host IFITM3,IFITM2 and IFITM1 facilitate morphogenesis of the human cytomegalovirus assembly.
More...

AA Sequence

MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNP      1 - 70
CCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG            71 - 133
//

Text Mined References (62)

PMID Year Title
26387945 2015 IFITM Proteins Restrict HIV-1 Infection by Antagonizing the Envelope Glycoprotein.
26354436 2015 The Interferon-induced Transmembrane Proteins, IFITM1, IFITM2, and IFITM3 Inhibit Hepatitis C Virus Entry.
26263374 2015 E3 Ubiquitin Ligase NEDD4 Promotes Influenza Virus Infection by Decreasing Levels of the Antiviral Protein IFITM3.
25942469 2015 Interferon-Inducible Transmembrane Protein 3 Genetic Variant rs12252 and Influenza Susceptibility and Severity: A Meta-Analysis.
25784441 2015 Interferon-induced transmembrane protein-3 rs12252-C is associated with rapid progression of acute HIV-1 infection in Chinese MSM cohort.
25778715 2015 IFITM3 rs12252 T>C polymorphism is associated with the risk of severe influenza: a meta-analysis.
25552713 2015 Human cytomegalovirus exploits interferon-induced transmembrane proteins to facilitate morphogenesis of the virion assembly compartment.
25464829 2014 IFITM proteins incorporated into HIV-1 virions impair viral fusion and spread.
25422070 2014 IFITM proteins are incorporated onto HIV-1 virion particles and negatively imprint their infectivity.
25405885 2014 Regulation of the trafficking and antiviral activity of IFITM3 by post-translational modifications.
More...