Property Summary

NCBI Gene PubMed Count 56
PubMed Score 126.00
PubTator Score 69.91

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q01628 Q53Y76 Q96HK8 Q96J15
Symbols 1-8U
IP15
DSPA2b

Gene

Gene RIF (85)

PMID Text
26387945 IFITM2 and IFITM3 specifically antagonize the HIV-1 envelope glycoprotein (Env), thereby inhibiting viral infection.
26387945 HIV-1 gp120 shedding is induced by IFITM3
26387945 HIV-1 gp120 shedding is induced by IFITM3
26387945 HIV-1 gp120 shedding is induced by IFITM3
26387945 HIV-1 gp120 shedding is induced by IFITM3
26387945 HIV-1 gp120 shedding is induced by IFITM3
26387945 HIV-1 gp120 shedding is induced by IFITM3
26387945 HIV-1 infectivity is inhibited when IFITM3 is expressed by the virus producing cell (293T cells)
26387945 HIV-1 infectivity is inhibited when IFITM3 is expressed by the virus producing cell (293T cells)
26354436 propose that the IFITM proteins act in a coordinated manner to restrict HCV infection by targeting the endocytosed HCV virion for lysosomal degradation and demonstrate that the actions of the IFITM proteins are indeed virus and cell-type specific
More...

AA Sequence

MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNP      1 - 70
CCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG            71 - 133
//

Publication (62)

PMID Year Title
26387945 2015 IFITM Proteins Restrict HIV-1 Infection by Antagonizing the Envelope Glycoprotein.
26354436 2015 The Interferon-induced Transmembrane Proteins, IFITM1, IFITM2, and IFITM3 Inhibit Hepatitis C Virus Entry.
26263374 2015 E3 Ubiquitin Ligase NEDD4 Promotes Influenza Virus Infection by Decreasing Levels of the Antiviral Protein IFITM3.
25942469 2015 Interferon-Inducible Transmembrane Protein 3 Genetic Variant rs12252 and Influenza Susceptibility and Severity: A Meta-Analysis.
25784441 2015 Interferon-induced transmembrane protein-3 rs12252-C is associated with rapid progression of acute HIV-1 infection in Chinese MSM cohort.
25778715 2015 IFITM3 rs12252 T>C polymorphism is associated with the risk of severe influenza: a meta-analysis.
25552713 2015 Human cytomegalovirus exploits interferon-induced transmembrane proteins to facilitate morphogenesis of the virion assembly compartment.
25464829 2014 IFITM proteins incorporated into HIV-1 virions impair viral fusion and spread.
25422070 2014 IFITM proteins are incorporated onto HIV-1 virion particles and negatively imprint their infectivity.
25405885 2014 Regulation of the trafficking and antiviral activity of IFITM3 by post-translational modifications.
More...