Property Summary

NCBI Gene PubMed Count 16
PubMed Score 40.27
PubTator Score 17.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 8.66288710914733E-11
malignant mesothelioma 3163 2.4120737096381E-8
non-small cell lung cancer 2798 4.94108168855857E-7
Pick disease 1893 8.46820339926E-5
osteosarcoma 7933 2.07403817677437E-4
psoriasis 6685 4.77910511201436E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00233659722730726
ovarian cancer 8492 0.00268060393645981
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00298537510943863
atypical teratoid/rhabdoid tumor 1095 0.00386511799333519
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00430141804041171
posterior fossa group B ependymoma 1530 0.00814160009859544
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00849259432067116
oligodendroglioma 2849 0.00885926525703711
active Crohn's disease 918 0.0107268024120973
invasive ductal carcinoma 2950 0.0208191158154987
Alzheimer's disease 644 0.0225292196724893
medulloblastoma, large-cell 6234 0.0252514357045009
chronic rhinosinusitis 512 0.0260109328947339
ductal carcinoma in situ 1745 0.0264868648411913
spina bifida 1064 0.0397774482546846
Hydrolethalus syndrome 128 0.0404765022053779
esophageal adenocarcinoma 737 0.0437819631926413
Gaucher disease type 1 171 0.0481801771429551

Expression

Synonym

Accession Q01581 B2RDL8 HMG-CoA synthase
Symbols HMGCS

Gene

PANTHER Protein Class (1)

PDB

2P8U  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid

Gene RIF (5)

PMID Text
20346956 The authors report high-resolution crystal structures of the human cytosolic (hHMGCS1) and mitochondrial (hHMGCS2) isoforms in binary product complexes.
19088433 ACBP is a transcriptional regulator of the HMGCS1 and HMGCR genes encoding rate-limiting enzymes of cholesterol synthesis pathway.
18854154 Knockdown of 3-hydroxy-3-methylglutaryl-CoA synthase 1 (HMGCS1) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18660489 Observational study of gene-disease association. (HuGE Navigator)
18636124 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPGSLPLNAEACWPKDVGIVALEIYFPSQYVDQAELEKYDGVDAGKYTIGLGQAKMGFCTDREDINSLCM      1 - 70
TVVQNLMERNNLSYDCIGRLEVGTETIIDKSKSVKTNLMQLFEESGNTDIEGIDTTNACYGGTAAVFNAV     71 - 140
NWIESSSWDGRYALVVAGDIAVYATGNARPTGGVGAVALLIGPNAPLIFERGLRGTHMQHAYDFYKPDML    141 - 210
SEYPIVDGKLSIQCYLSALDRCYSVYCKKIHAQWQKEGNDKDFTLNDFGFMIFHSPYCKLVQKSLARMLL    211 - 280
NDFLNDQNRDKNSIYSGLEAFGDVKLEDTYFDRDVEKAFMKASSELFSQKTKASLLVSNQNGNMYTSSVY    281 - 350
GSLASVLAQYSPQQLAGKRIGVFSYGSGLAATLYSLKVTQDATPGSALDKITASLCDLKSRLDSRTGVAP    351 - 420
DVFAENMKLREDTHHLVNYIPQGSIDSLFEGTWYLVRVDEKHRRTYARRPTPNDDTLDEGVGLVHSNIAT    421 - 490
EHIPSPAKKVPRLPATAAEPEAAVISNGEH                                            491 - 520
//

Text Mined References (25)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20346956 2010 Crystal structures of human HMG-CoA synthase isoforms provide insights into inherited ketogenesis disorders and inhibitor design.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19088433 2008 Transcriptional regulation of HMG-CoA synthase and HMG-CoA reductase genes by human ACBP.
More...