Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.97
PubTator Score 78.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 6.1e-19
medulloblastoma, large-cell 6241 2.7e-05
osteosarcoma 7950 7.1e-05
diabetes mellitus 1728 2.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Griscelli syndrome 24 3.91 2.0

Expression

  Differential Expression (4)

Disease log2 FC p
diabetes mellitus 1.400 2.4e-03
medulloblastoma, large-cell 1.500 2.7e-05
osteosarcoma 1.027 7.1e-05
psoriasis 2.700 6.1e-19

Synonym

Accession Q01546 B4DRR3 Q7Z795
Symbols KRT2B
KRT2P
HUMCYT2A

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MNRQVCKKSFSGRSQGFSGRSAVVSGSSRMSCVARSGGAGGGACGFRSGAGSFGSRSLYNLGSNKSISIS      1 - 70
VAAGSSRAGGFGGGRSSCGFAGGYGGGFGGSYGGGFGGGRGVGSGFGGAGGFGGAGGFGGPGVFGGPGSF     71 - 140
GGPGGFGPGGFPGGIQEVIVNQSLLQPLNVEIDPQIGQVKAQEREQIKTLNNKFASFIDKVRFLEQQNKV    141 - 210
LETKWELLQQQTTGSGPSSLEPCFESYISFLCKQLDSLLGERGNLEGELKSMQDLVEDFKKKYEDEINKR    211 - 280
TAAENEFVGLKKDVDAAFMNKVELQAKVDSLTDEVSFLRTLYEMELSQMQSHASDTSVVLSMDNNRCLDL    281 - 350
GSIIAEVRAQYEEIAQRSKSEAEALYQTKLGELQTTAGRHGDDLRNTKSEIMELNRMIQRLRAEIENVKK    351 - 420
QNANLQTAIAEAEQRGEMALKDANAKLQDLQTALQKAKDDLARLLRDYQELMNVKLALDVEIATYRKLLE    421 - 490
GEECRMSGECQSAVCISVVSNVTSTSGSSGSSRGVFGGVSGSGSGGYKGGSSSSSSSGYGVSGGSGSGYG    491 - 560
GVSSGSTGGRGSSGSYQSSSSGSRLGGAGSISVSHSGMGSSSGSIQTSGGSGYKSGGGGSTSIRFSQTTS    561 - 630
SSQHSSTK                                                                  631 - 638
//

Text Mined References (11)

PMID Year Title