Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.97
PubTator Score 78.71

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma 1.027 0.000
medulloblastoma, large-cell 1.500 0.000
diabetes mellitus 1.400 0.002
psoriasis 2.700 0.000

Synonym

Accession Q01546 B4DRR3 Q7Z795
Symbols KRT2B
KRT2P
HUMCYT2A

Gene

AA Sequence

MNRQVCKKSFSGRSQGFSGRSAVVSGSSRMSCVARSGGAGGGACGFRSGAGSFGSRSLYNLGSNKSISIS      1 - 70
VAAGSSRAGGFGGGRSSCGFAGGYGGGFGGSYGGGFGGGRGVGSGFGGAGGFGGAGGFGGPGVFGGPGSF     71 - 140
GGPGGFGPGGFPGGIQEVIVNQSLLQPLNVEIDPQIGQVKAQEREQIKTLNNKFASFIDKVRFLEQQNKV    141 - 210
LETKWELLQQQTTGSGPSSLEPCFESYISFLCKQLDSLLGERGNLEGELKSMQDLVEDFKKKYEDEINKR    211 - 280
TAAENEFVGLKKDVDAAFMNKVELQAKVDSLTDEVSFLRTLYEMELSQMQSHASDTSVVLSMDNNRCLDL    281 - 350
GSIIAEVRAQYEEIAQRSKSEAEALYQTKLGELQTTAGRHGDDLRNTKSEIMELNRMIQRLRAEIENVKK    351 - 420
QNANLQTAIAEAEQRGEMALKDANAKLQDLQTALQKAKDDLARLLRDYQELMNVKLALDVEIATYRKLLE    421 - 490
GEECRMSGECQSAVCISVVSNVTSTSGSSGSSRGVFGGVSGSGSGGYKGGSSSSSSSGYGVSGGSGSGYG    491 - 560
GVSSGSTGGRGSSGSYQSSSSGSRLGGAGSISVSHSGMGSSSGSIQTSGGSGYKSGGGGSTSIRFSQTTS    561 - 630
SSQHSSTK                                                                  631 - 638
//

Text Mined References (11)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16831889 2006 New consensus nomenclature for mammalian keratins.
16541075 2006 The finished DNA sequence of human chromosome 12.
15737194 2005 Characterization of new members of the human type II keratin gene family and a general evaluation of the keratin gene domain on chromosome 12q13.13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...