Property Summary

NCBI Gene PubMed Count 128
PubMed Score 60.12
PubTator Score 387.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
lung carcinoma 2844 1.34966519185843E-25
non-small cell lung cancer 2798 8.0233906207983E-22
lung adenocarcinoma 2714 1.09310575013314E-10
malignant mesothelioma 3163 4.64859285875605E-7
lung cancer 4473 1.30210633366016E-6
pilocytic astrocytoma 3086 1.36244353308005E-6
osteosarcoma 7933 2.66249416733384E-6
cystic fibrosis 1670 7.31395068704404E-6
ulcerative colitis 2087 2.32544471336989E-5
tuberculosis 1563 2.83910596031575E-5
primary Sjogren syndrome 789 5.72471087232896E-5
ovarian cancer 8492 1.00173526010345E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 4.33889627070708E-4
interstitial cystitis 2299 4.53453957166423E-4
nephrosclerosis 329 9.22302578262237E-4
Multiple myeloma 1328 0.0025502710626061
Waldenstrons macroglobulinemia 765 0.00635138252857996
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00766946026553815
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00791911816729272
cutaneous lupus erythematosus 1056 0.0182503419266411
Disease Target Count Z-score Confidence
Globe disease 57 0.0 2.0
Disease Target Count Z-score Confidence
Cancer 2346 0.0 4.0
Disease Target Count Z-score Confidence
Sarcoma 49 3.573 1.8

Expression

Synonym

Accession Q01543 B2R8H2 B4DFV4 B4DTC6 G3V183 Q14319 Q92480 Q9UE07
Symbols EWSR2
SIC-1

Gene

PANTHER Protein Class (1)

PDB

1FLI   1X66   2YTU   5E8G   5E8I   5JVT  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (94)

PMID Text
27052461 Concurrent exogenous expression of three transcription factors, GATA1, FLI1 and TAL1, enables large-scale production of megakaryocytes from human pluripotent stem cells.
26336820 Identify SP1 and PI3K/AKT signaling as modulators of EWS/FLI1 gene expression in tumor cell lines.
26316623 Mutation in FLI1 is associated with Paris-Trousseau thrombocytopenia.
26305602 Fli-1 expression gradually increases in parallel with disease progression.
26261664 Case Report: SMARCB1-deficient vulvar sarcoma expressing ERG and FLI1.
26159733 erythrocyte lineage enforces exclusivity through upregulation of EKLF and its lineage-specific cytokine receptor (EpoR) while inhibiting both FLI-1 and the receptor TpoR (also known as MPL) for the opposing megakaryocyte lineage
26156017 This study for the first time identifies FLI1 as a clinically and functionally important target gene of metastasis, providing a rationale for developing FLI1 inhibitors in the treatment of breast cancer.
26063314 Overexpression of FLI1 and ERG genes is sufficient to transdifferentiate erythroblasts to megakaryocytes that can produce functional platelets.
26055516 Fli1 is epigenetically suppressed and is a potential predisposing factor in the pathogenesis of systemic sclerosis. (Review)
25779942 SLFN11 has a role as a transcriptional target of EWS-FLI1 and is a determinant of drug response in Ewing sarcoma
More...

AA Sequence

MDGTIKEALSVVSDDQSLFDSAYGAAAHLPKADMTASGSPDYGQPHKINPLPPQQEWINQPVRVNVKREY      1 - 70
DHMNGSRESPVDCSVSKCSKLVGGGESNPMNYNSYMDEKNGPPPPNMTTNERRVIVPADPTLWTQEHVRQ     71 - 140
WLEWAIKEYSLMEIDTSFFQNMDGKELCKMNKEDFLRATTLYNTEVLLSHLSYLRESSLLAYNTTSHTDQ    141 - 210
SSRLSVKEDPSYDSVRRGAWGNNMNSGLNKSPPLGGAQTISKNTEQRPQPDPYQILGPTSSRLANPGSGQ    211 - 280
IQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTK    281 - 350
VHGKRYAYKFDFHGIAQALQPHPTESSMYKYPSDISYMPSYHAHQQKVNFVPPHPSSMPVTSSSFFGAAS    351 - 420
QYWTSPTGGIYPNPNVPRHPNTHVPSHLGSYY                                          421 - 452
//

Text Mined References (131)

PMID Year Title
27052461 2016 Large-scale production of megakaryocytes from human pluripotent stem cells by chemically defined forward programming.
26336820 2015 PI3K/AKT signaling modulates transcriptional expression of EWS/FLI1 through specificity protein 1.
26316623 2015 Paris-Trousseau thrombocytopenia is phenocopied by the autosomal recessive inheritance of a DNA-binding domain mutation in FLI1.
26305602 2015 Overexpression of Fli-1 is associated with adverse prognosis of endometrial cancer.
26261664 2015 A SMARCB1-deficient vulvar neoplasm with prominent myxoid stroma: report of a case showing ERG and FLI1 expression.
26159733 2015 Robust hematopoietic progenitor cell commitment in the presence of a conflicting cue.
26156017 2015 Friend leukemia virus integration 1 activates the Rho GTPase pathway and is associated with metastasis in breast cancer.
26063314 2015 Transdifferentiation of erythroblasts to megakaryocytes using FLI1 and ERG transcription factors.
26055516 2015 Epigenetic suppression of Fli1, a potential predisposing factor in the pathogenesis of systemic sclerosis.
25779942 2015 SLFN11 Is a Transcriptional Target of EWS-FLI1 and a Determinant of Drug Response in Ewing Sarcoma.
More...