Property Summary

NCBI Gene PubMed Count 128
Grant Count 219
R01 Count 106
Funding $19,248,708.22
PubMed Score 60.12
PubTator Score 387.45

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q01543 B2R8H2 B4DFV4 B4DTC6 G3V183 Q14319 Q92480 Q9UE07
Symbols EWSR2
SIC-1

Gene

PANTHER Protein Class (1)

PDB

1FLI   1X66   2YTU   5E8G   5E8I   5JVT  

Gene RIF (94)

PMID Text
27052461 Concurrent exogenous expression of three transcription factors, GATA1, FLI1 and TAL1, enables large-scale production of megakaryocytes from human pluripotent stem cells.
26336820 Identify SP1 and PI3K/AKT signaling as modulators of EWS/FLI1 gene expression in tumor cell lines.
26316623 Mutation in FLI1 is associated with Paris-Trousseau thrombocytopenia.
26305602 Fli-1 expression gradually increases in parallel with disease progression.
26261664 Case Report: SMARCB1-deficient vulvar sarcoma expressing ERG and FLI1.
26159733 erythrocyte lineage enforces exclusivity through upregulation of EKLF and its lineage-specific cytokine receptor (EpoR) while inhibiting both FLI-1 and the receptor TpoR (also known as MPL) for the opposing megakaryocyte lineage
26156017 This study for the first time identifies FLI1 as a clinically and functionally important target gene of metastasis, providing a rationale for developing FLI1 inhibitors in the treatment of breast cancer.
26063314 Overexpression of FLI1 and ERG genes is sufficient to transdifferentiate erythroblasts to megakaryocytes that can produce functional platelets.
26055516 Fli1 is epigenetically suppressed and is a potential predisposing factor in the pathogenesis of systemic sclerosis. (Review)
25779942 SLFN11 has a role as a transcriptional target of EWS-FLI1 and is a determinant of drug response in Ewing sarcoma
More...

AA Sequence

MDGTIKEALSVVSDDQSLFDSAYGAAAHLPKADMTASGSPDYGQPHKINPLPPQQEWINQPVRVNVKREY      1 - 70
DHMNGSRESPVDCSVSKCSKLVGGGESNPMNYNSYMDEKNGPPPPNMTTNERRVIVPADPTLWTQEHVRQ     71 - 140
WLEWAIKEYSLMEIDTSFFQNMDGKELCKMNKEDFLRATTLYNTEVLLSHLSYLRESSLLAYNTTSHTDQ    141 - 210
SSRLSVKEDPSYDSVRRGAWGNNMNSGLNKSPPLGGAQTISKNTEQRPQPDPYQILGPTSSRLANPGSGQ    211 - 280
IQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTK    281 - 350
VHGKRYAYKFDFHGIAQALQPHPTESSMYKYPSDISYMPSYHAHQQKVNFVPPHPSSMPVTSSSFFGAAS    351 - 420
QYWTSPTGGIYPNPNVPRHPNTHVPSHLGSYY                                          421 - 452
//

Text Mined References (131)

PMID Year Title
27052461 2016 Large-scale production of megakaryocytes from human pluripotent stem cells by chemically defined forward programming.
26336820 2015 PI3K/AKT signaling modulates transcriptional expression of EWS/FLI1 through specificity protein 1.
26316623 2015 Paris-Trousseau thrombocytopenia is phenocopied by the autosomal recessive inheritance of a DNA-binding domain mutation in FLI1.
26305602 2015 Overexpression of Fli-1 is associated with adverse prognosis of endometrial cancer.
26261664 2015 A SMARCB1-deficient vulvar neoplasm with prominent myxoid stroma: report of a case showing ERG and FLI1 expression.
26159733 2015 Robust hematopoietic progenitor cell commitment in the presence of a conflicting cue.
26156017 2015 Friend leukemia virus integration 1 activates the Rho GTPase pathway and is associated with metastasis in breast cancer.
26063314 2015 Transdifferentiation of erythroblasts to megakaryocytes using FLI1 and ERG transcription factors.
26055516 2015 Epigenetic suppression of Fli1, a potential predisposing factor in the pathogenesis of systemic sclerosis.
25779942 2015 SLFN11 Is a Transcriptional Target of EWS-FLI1 and a Determinant of Drug Response in Ewing Sarcoma.
More...