Property Summary

NCBI Gene PubMed Count 1
Grant Count 2
Funding $87,675.25
PubMed Score 95.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

AA Sequence

MRPEGSLTYRVPERLRQGFCGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGEEAVLLLDDI      1 - 70
MAEVEVVAEEEGLVERREEAQRAQQAVPGPGPMTPESAPEELLAVQVELEPVNAQARKAFSRQREKMERR     71 - 140
RKPHLDRRGAVIQSVPGFWANVIANHPQMSALITDEDEDMLSYMVSLEVGEEKHPVHLCKIMLFFRSNPY    141 - 210
FQNKVITKEYLVNITEYRASHSTPIEWYPDYEVEAYRRRHHNSSLNFFNWFSDHNFAGSNKIAEILCKDL    211 - 280
WRNPLQYYKRMKPPEEGTETSGDSQLLS                                              281 - 308
//

Text Mined References (14)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12815422 2003 The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes.
12527192 2003 Expression, alternative splicing and haplotype analysis of transcribed testis specific protein (TSPY) genes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11173850 2000 Expression of a candidate gene for the gonadoblastoma locus in gonadoblastoma and testicular seminoma.
11173833 2000 TSPY variants in six loci on the human Y chromosome.
10773691 2000 Characterization of a new TSPY gene family member in Yq (TSPYq1).
10747295 2000 Expression analysis of thirty one Y chromosome genes in human prostate cancer.
10090875 1999 Gonadoblastoma, testicular and prostate cancers, and the TSPY gene.
8923009 1996 Testis-specific protein, Y-encoded (TSPY) expression in testicular tissues.
More...