Property Summary

NCBI Gene PubMed Count 30
PubMed Score 19.28
PubTator Score 6.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Colitis, Ulcerative 59 0.0 0.0
Disease Target Count
ulcerative colitis 1819
Disease Target Count P-value
psoriasis 6694 1.5e-11
lung cancer 4740 7.5e-05
diabetes mellitus 1728 1.0e-03
active ulcerative colitis 764 1.5e-02
active Crohn's disease 922 1.7e-02
Disease Target Count Z-score Confidence
Crohn's disease 321 3.781 1.9
Dacryocystitis 11 3.129 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
active Crohn's disease 5.188 1.7e-02
active ulcerative colitis 5.129 1.5e-02
diabetes mellitus 1.100 1.0e-03
lung cancer 3.900 7.5e-05
psoriasis -3.000 1.5e-11

Gene RIF (22)

AA Sequence

MRTLTILTAVLLVALQAKAEPLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAF      1 - 70
TCHCRRSCYSTEYSYGTCTVMGINHRFCCL                                             71 - 100
//

Text Mined References (31)

PMID Year Title