Property Summary

NCBI Gene PubMed Count 27
PubMed Score 18.22
PubTator Score 6.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
ulcerative colitis 2087
Disease Target Count P-value
psoriasis 6685 1.45417769999318E-11
lung cancer 4473 1.00687324147678E-7
diabetes mellitus 1663 0.00104821351867176
active ulcerative colitis 477 0.0152969893433973
active Crohn's disease 918 0.0169763001777841
Disease Target Count Z-score Confidence
Crohn's disease 304 3.781 1.9
Dacryocystitis 7 3.132 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
lung cancer 7.500 0.000
active Crohn's disease 5.188 0.017
active ulcerative colitis 5.129 0.015
diabetes mellitus 1.100 0.001
psoriasis -3.000 0.000

Synonym

Accession Q01524 Q6EZF9
Symbols DEF6
HD-6

Gene

PDB

1ZMQ   3QTE  

  Ortholog (1)

Species Source
Mouse OMA EggNOG

Gene RIF (19)

PMID Text
25433720 Authors show that although NOD2 by itself can slightly up-regulate expression of HD5 and HD6, it can strongly down-regulates their expression during differentiation of the Paneth cell lineage mainly by inhibiting activation of the MAPK pathway.
25354318 Paneth cell alpha-defensin 6 is an antimicrobial peptide.
25158166 Native HD-6 readily self-assembles into elongated fibrils observable by transmission electron microscopy, agglutinates both Gram-negative and -positive bacteria, and prevents the Listeria monocytogenes from invading cultured cells.
23028900 In the meta-analysis, DEFA6 rs13275170 and DEFB1 rs2738169 had both a 1.3-fold increased odds ratio for gastric cancer.
22722251 study reports that HD6 affords protection against invasion by enteric bacterial pathogens in vitro and in vivo; after stochastic binding to bacterial surface proteins, HD6 undergoes ordered self-assembly to form fibrils and nanonets that surround and entangle bacteria
21873175 Regions 2, 3 & 9, 10 were more hydrophobic than other regions. It was difficult for the HD molecule to have many conformations because of its 3 S-S bridges; however, it responds to various external factors by restricting conformation.
21734566 Alpha-defensins inhibit the binding of HIV-1 gp120 to CD4 through interaction with the D1 domain of CD4
21672195 Defensins 5 and 6 enhance HIV-1 infectivity through promoting HIV attachment.
20979654 Defensin alpha 6 (DEFA 6) may have a role in adenoma but not in progression to colon carcinoma
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
More...

AA Sequence

MRTLTILTAVLLVALQAKAEPLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAF      1 - 70
TCHCRRSCYSTEYSYGTCTVMGINHRFCCL                                             71 - 100
//

Text Mined References (28)

PMID Year Title
25433720 2015 Regulation of human enteric ?-defensins by NOD2 in the Paneth cell lineage.
25416956 2014 A proteome-scale map of the human interactome network.
25354318 2015 Paneth cell ?-defensin 6 (HD-6) is an antimicrobial peptide.
25158166 2014 Molecular basis for self-assembly of a human host-defense peptide that entraps bacterial pathogens.
24954895 2014 Gene-age interactions in blood pressure regulation: a large-scale investigation with the CHARGE, Global BPgen, and ICBP Consortia.
23028900 2012 Innate immunity and non-Hodgkin's lymphoma (NHL) related genes in a nested case-control study for gastric cancer risk.
22722251 2012 Human ?-defensin 6 promotes mucosal innate immunity through self-assembled peptide nanonets.
21873175 2011 Efficiency of antimicrobial defense: molecular flexibility of natural defensin and artificial bis-quaternary ammonium compound.
21672195 2011 Human defensins 5 and 6 enhance HIV-1 infectivity through promoting HIV attachment.
20979654 2010 Defensin alpha 6 (DEFA 6) overexpression threshold of over 60 fold can distinguish between adenoma and fully blown colon carcinoma in individual patients.
More...