Property Summary

NCBI Gene PubMed Count 27
Grant Count 1
Funding $98,966.25
PubMed Score 18.22
PubTator Score 6.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
lung cancer 7.500 0.000
active Crohn's disease 5.188 0.017
active ulcerative colitis 5.129 0.015
diabetes mellitus 1.100 0.001
psoriasis -3.000 0.000

Synonym

Accession Q01524 Q6EZF9
Symbols DEF6
HD-6

Gene

 Grant Application (1)

PDB

1ZMQ   3QTE  

Gene RIF (19)

PMID Text
25433720 Authors show that although NOD2 by itself can slightly up-regulate expression of HD5 and HD6, it can strongly down-regulates their expression during differentiation of the Paneth cell lineage mainly by inhibiting activation of the MAPK pathway.
25354318 Paneth cell alpha-defensin 6 is an antimicrobial peptide.
25158166 Native HD-6 readily self-assembles into elongated fibrils observable by transmission electron microscopy, agglutinates both Gram-negative and -positive bacteria, and prevents the Listeria monocytogenes from invading cultured cells.
23028900 In the meta-analysis, DEFA6 rs13275170 and DEFB1 rs2738169 had both a 1.3-fold increased odds ratio for gastric cancer.
22722251 study reports that HD6 affords protection against invasion by enteric bacterial pathogens in vitro and in vivo; after stochastic binding to bacterial surface proteins, HD6 undergoes ordered self-assembly to form fibrils and nanonets that surround and entangle bacteria
21873175 Regions 2, 3 & 9, 10 were more hydrophobic than other regions. It was difficult for the HD molecule to have many conformations because of its 3 S-S bridges; however, it responds to various external factors by restricting conformation.
21734566 Alpha-defensins inhibit the binding of HIV-1 gp120 to CD4 through interaction with the D1 domain of CD4
21672195 Defensins 5 and 6 enhance HIV-1 infectivity through promoting HIV attachment.
20979654 Defensin alpha 6 (DEFA 6) may have a role in adenoma but not in progression to colon carcinoma
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
More...

AA Sequence

MRTLTILTAVLLVALQAKAEPLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAF      1 - 70
TCHCRRSCYSTEYSYGTCTVMGINHRFCCL                                             71 - 100
//

Publication (28)

PMID Year Title
25433720 2015 Regulation of human enteric ?-defensins by NOD2 in the Paneth cell lineage.
25416956 2014 A proteome-scale map of the human interactome network.
25354318 2015 Paneth cell ?-defensin 6 (HD-6) is an antimicrobial peptide.
25158166 2014 Molecular basis for self-assembly of a human host-defense peptide that entraps bacterial pathogens.
24954895 2014 Gene-age interactions in blood pressure regulation: a large-scale investigation with the CHARGE, Global BPgen, and ICBP Consortia.
23028900 2012 Innate immunity and non-Hodgkin's lymphoma (NHL) related genes in a nested case-control study for gastric cancer risk.
22722251 2012 Human ?-defensin 6 promotes mucosal innate immunity through self-assembled peptide nanonets.
21873175 2011 Efficiency of antimicrobial defense: molecular flexibility of natural defensin and artificial bis-quaternary ammonium compound.
21672195 2011 Human defensins 5 and 6 enhance HIV-1 infectivity through promoting HIV attachment.
20979654 2010 Defensin alpha 6 (DEFA 6) overexpression threshold of over 60 fold can distinguish between adenoma and fully blown colon carcinoma in individual patients.
More...