Property Summary

NCBI Gene PubMed Count 66
PubMed Score 88.33
PubTator Score 125.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
active Crohn's disease 4.401 1.8e-02
active ulcerative colitis 4.447 1.2e-02
lung cancer 4.700 6.9e-06

Gene RIF (60)

AA Sequence

MRTIAILAAILLVALQAQAESLQERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRTG      1 - 70
RCATRESLSGVCEISGRLYRLCCR                                                   71 - 94
//

Text Mined References (67)

PMID Year Title