Property Summary

NCBI Gene PubMed Count 60
Grant Count 11
R01 Count 3
Funding $1,718,714.35
PubMed Score 82.86
PubTator Score 125.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
ulcerative colitis 4.800 0.001
lung cancer 6.900 0.000
active Crohn's disease 4.401 0.018

Gene RIF (56)

PMID Text
26206286 a moderately active linear peptide derived from the alpha-defensin HD5 can be engineered to enhance antimicrobial activity almost comparable to the native peptide.
25970658 The study used ion mobility coupled to mass spectrometry to track the structural changes in HD-5 upon disulfide bond reduction.
25664683 HD5ox, at least in part, exerts its antibacterial activity against E. coli and other Gram-negative microbes in the cytoplasm.
25540379 These data support a model in which HD5 prevents furin from accessing human papillomavirus 16 L2 by occluding the furin cleavage site via direct binding to the viral capsid.
25517613 Enteric alpha-defensin HD5 and beta-defensin hBD2 shared similar toxin-unfolding effects with HNP1, albeit to different degrees.
25433720 Authors show that although NOD2 by itself can slightly up-regulate expression of HD5 and HD6, it can strongly down-regulates their expression during differentiation of the Paneth cell lineage mainly by inhibiting activation of the MAPK pathway.
25430675 The study reports the screening of human defensin 5 against the Keio Collection of E. coli strains and shows how this important hostdefense peptide kills bacteria and how bacteria protect themselves against the attack from the human host.
25196670 our results highlight the potential contribution of altered alpha-defensin HD-5 expression in the formation of a viral/tumour-permissive environment in high-risk HPV infection and progression to cancer of the uterine cervix
24681099 Data indicate that cellular effects of defensin 5 involve interactions with the extra-cellular domain of tumor necrosis Factor 1.
24198413 HD5 neutralizes JC polyomavirus infection by stabilizing the viral capsid and disrupting virus trafficking.
More...

AA Sequence

MRTIAILAAILLVALQAQAESLQERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRTG      1 - 70
RCATRESLSGVCEISGRLYRLCCR                                                   71 - 94
//

Text Mined References (61)

PMID Year Title
26206286 2015 Antimicrobial activity of human ?-defensin 5 and its linear analogs: N-terminal fatty acylation results in enhanced antimicrobial activity of the linear analogs.
25970658 2015 Conformational landscape and pathway of disulfide bond reduction of human alpha defensin.
25664683 2015 Visualizing attack of Escherichia coli by the antimicrobial peptide human defensin 5.
25540379 2015 Alpha-defensin HD5 inhibits furin cleavage of human papillomavirus 16 L2 to block infection.
25517613 2014 Human defensins facilitate local unfolding of thermodynamically unstable regions of bacterial protein toxins.
25433720 2015 Regulation of human enteric ?-defensins by NOD2 in the Paneth cell lineage.
25430675 2014 A bacterial mutant library as a tool to study the attack of a defensin peptide.
25196670 2014 Altered ?-defensin 5 expression in cervical squamocolumnar junction: implication in the formation of a viral/tumour-permissive microenvironment.
24681099 2014 Functional intersection of Human Defensin 5 with the TNF receptor pathway.
24198413 2014 The human alpha defensin HD5 neutralizes JC polyomavirus infection by reducing endoplasmic reticulum traffic and stabilizing the viral capsid.
More...